The complete mitochondrial genome of Megaderma lyra (Indian false vampire)

The Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China....

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Mengjia, Lan, Yanhong, Cao, Yi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2018
Materias:
Mitogenome Announcement
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7800915/
https://www.ncbi.nlm.nih.gov/pubmed/33474151
http://dx.doi.org/10.1080/23802359.2018.1443851
_version_ 1783635460013162496
author Liu, Mengjia
Lan, Yanhong
Cao, Yi
author_facet Liu, Mengjia
Lan, Yanhong
Cao, Yi
author_sort Liu, Mengjia
collection PubMed
description The Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China. Herein, we described 17,055 bp of M. lyra mtDNA that includes 13 protein-coding genes (PGCs), two rRNA genes (12S rRNA and 16S rRNA), 22 transfer RNA (tRNA) genes, and one control region (D-loop). The complete mitochondrial genome sequence will provide new molecular biology information to further understand the genetic diversity of the M. lyra and to protect this population.
format Online
Article
Text
id pubmed-7800915
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-78009152021-01-19 The complete mitochondrial genome of Megaderma lyra (Indian false vampire) Liu, Mengjia Lan, Yanhong Cao, Yi Mitochondrial DNA B Resour Mitogenome Announcement The Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China. Herein, we described 17,055 bp of M. lyra mtDNA that includes 13 protein-coding genes (PGCs), two rRNA genes (12S rRNA and 16S rRNA), 22 transfer RNA (tRNA) genes, and one control region (D-loop). The complete mitochondrial genome sequence will provide new molecular biology information to further understand the genetic diversity of the M. lyra and to protect this population. Taylor & Francis 2018-02-26 /pmc/articles/PMC7800915/ /pubmed/33474151 http://dx.doi.org/10.1080/23802359.2018.1443851 Text en © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/
spellingShingle Mitogenome Announcement
Liu, Mengjia
Lan, Yanhong
Cao, Yi
The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title_full The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title_fullStr The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title_full_unstemmed The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title_short The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
title_sort complete mitochondrial genome of megaderma lyra (indian false vampire)
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7800915/
https://www.ncbi.nlm.nih.gov/pubmed/33474151
http://dx.doi.org/10.1080/23802359.2018.1443851
work_keys_str_mv AT liumengjia thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire
AT lanyanhong thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire
AT caoyi thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire
AT liumengjia completemitochondrialgenomeofmegadermalyraindianfalsevampire
AT lanyanhong completemitochondrialgenomeofmegadermalyraindianfalsevampire
AT caoyi completemitochondrialgenomeofmegadermalyraindianfalsevampire

Ejemplares similares