Cargando…

The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children

Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdi...

Descripción completa

Detalles Bibliográficos
Autores principales: Saad, Michelle, Syed, Sabeen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Wolters Kluwer 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7808463/
https://www.ncbi.nlm.nih.gov/pubmed/33457437
http://dx.doi.org/10.14309/crj.0000000000000516
_version_ 1783636902849544192
author Saad, Michelle
Syed, Sabeen
author_facet Saad, Michelle
Syed, Sabeen
author_sort Saad, Michelle
collection PubMed
description Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdiagnosed with familial hypercholesterolemia. The absence of a suggestive family history triggered further testing that revealed complete lysosomal acid lipase deficiency that typically presents in infancy as Wolman disease with failure to thrive, malabsorption, and liver failure. Interestingly, the patient's clinical picture suggested cholesteryl ester storage disease instead, a milder phenotype in older patients.
format Online
Article
Text
id pubmed-7808463
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Wolters Kluwer
record_format MEDLINE/PubMed
spelling pubmed-78084632021-01-15 The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children Saad, Michelle Syed, Sabeen ACG Case Rep J Case Report Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdiagnosed with familial hypercholesterolemia. The absence of a suggestive family history triggered further testing that revealed complete lysosomal acid lipase deficiency that typically presents in infancy as Wolman disease with failure to thrive, malabsorption, and liver failure. Interestingly, the patient's clinical picture suggested cholesteryl ester storage disease instead, a milder phenotype in older patients. Wolters Kluwer 2021-01-13 /pmc/articles/PMC7808463/ /pubmed/33457437 http://dx.doi.org/10.14309/crj.0000000000000516 Text en © 2021 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of The American College of Gastroenterology. This is an open access article distributed under the terms of the Creative Commons Attribution-Non Commercial-No Derivatives License 4.0 (CCBY-NC-ND) (http://creativecommons.org/licenses/by-nc-nd/4.0/) , where it is permissible to download and share the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal.
spellingShingle Case Report
Saad, Michelle
Syed, Sabeen
The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title_full The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title_fullStr The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title_full_unstemmed The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title_short The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
title_sort emerging battle: lysosomal acid lipase deficiency vs familial hypercholesterolemia in children
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7808463/
https://www.ncbi.nlm.nih.gov/pubmed/33457437
http://dx.doi.org/10.14309/crj.0000000000000516
work_keys_str_mv AT saadmichelle theemergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren
AT syedsabeen theemergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren
AT saadmichelle emergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren
AT syedsabeen emergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren