Cargando…
The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children
Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdi...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7808463/ https://www.ncbi.nlm.nih.gov/pubmed/33457437 http://dx.doi.org/10.14309/crj.0000000000000516 |
_version_ | 1783636902849544192 |
---|---|
author | Saad, Michelle Syed, Sabeen |
author_facet | Saad, Michelle Syed, Sabeen |
author_sort | Saad, Michelle |
collection | PubMed |
description | Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdiagnosed with familial hypercholesterolemia. The absence of a suggestive family history triggered further testing that revealed complete lysosomal acid lipase deficiency that typically presents in infancy as Wolman disease with failure to thrive, malabsorption, and liver failure. Interestingly, the patient's clinical picture suggested cholesteryl ester storage disease instead, a milder phenotype in older patients. |
format | Online Article Text |
id | pubmed-7808463 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Wolters Kluwer |
record_format | MEDLINE/PubMed |
spelling | pubmed-78084632021-01-15 The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children Saad, Michelle Syed, Sabeen ACG Case Rep J Case Report Lysosomal acid lipase is an under-recognized enzyme involved in the modulation and expression of genes that part-take in the synthesis and uptake of cholesterol. We describe the unusual course of a 2-year-old patient who presented with hypercholesterolemia and elevated liver enzymes, initially misdiagnosed with familial hypercholesterolemia. The absence of a suggestive family history triggered further testing that revealed complete lysosomal acid lipase deficiency that typically presents in infancy as Wolman disease with failure to thrive, malabsorption, and liver failure. Interestingly, the patient's clinical picture suggested cholesteryl ester storage disease instead, a milder phenotype in older patients. Wolters Kluwer 2021-01-13 /pmc/articles/PMC7808463/ /pubmed/33457437 http://dx.doi.org/10.14309/crj.0000000000000516 Text en © 2021 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of The American College of Gastroenterology. This is an open access article distributed under the terms of the Creative Commons Attribution-Non Commercial-No Derivatives License 4.0 (CCBY-NC-ND) (http://creativecommons.org/licenses/by-nc-nd/4.0/) , where it is permissible to download and share the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal. |
spellingShingle | Case Report Saad, Michelle Syed, Sabeen The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title | The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title_full | The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title_fullStr | The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title_full_unstemmed | The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title_short | The Emerging Battle: Lysosomal Acid Lipase Deficiency vs Familial Hypercholesterolemia in Children |
title_sort | emerging battle: lysosomal acid lipase deficiency vs familial hypercholesterolemia in children |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7808463/ https://www.ncbi.nlm.nih.gov/pubmed/33457437 http://dx.doi.org/10.14309/crj.0000000000000516 |
work_keys_str_mv | AT saadmichelle theemergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren AT syedsabeen theemergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren AT saadmichelle emergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren AT syedsabeen emergingbattlelysosomalacidlipasedeficiencyvsfamilialhypercholesterolemiainchildren |