Cargando…

The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)

BACKGROUND: [(68) Ga]Ga-DOTATATE PET/CT is now recognised as the most sensitive functional imaging modality for the diagnosis of well-differentiated neuroendocrine tumours (NET) and can inform treatment with peptide receptor radionuclide therapy with [(177)Lu]Lu-DOTATATE. However, somatostatin recep...

Descripción completa

Detalles Bibliográficos
Autores principales: Aloj, Luigi, Giger, Olivier, Mendichovszky, Iosif A., Challis, Ben G., Ronel, Meytar, Harper, Ines, Cheow, Heok, Hoopen, Rogier ten, Pitfield, Deborah, Gallagher, Ferdia A., Attili, Bala, McLean, Mary, Jones, Robin L., Dileo, Palma, Bulusu, Venkata Ramesh, Maher, Eamonn R., Casey, Ruth T.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Berlin Heidelberg 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7809083/
https://www.ncbi.nlm.nih.gov/pubmed/33443647
http://dx.doi.org/10.1186/s13550-021-00747-0
_version_ 1783637043202490368
author Aloj, Luigi
Giger, Olivier
Mendichovszky, Iosif A.
Challis, Ben G.
Ronel, Meytar
Harper, Ines
Cheow, Heok
Hoopen, Rogier ten
Pitfield, Deborah
Gallagher, Ferdia A.
Attili, Bala
McLean, Mary
Jones, Robin L.
Dileo, Palma
Bulusu, Venkata Ramesh
Maher, Eamonn R.
Casey, Ruth T.
author_facet Aloj, Luigi
Giger, Olivier
Mendichovszky, Iosif A.
Challis, Ben G.
Ronel, Meytar
Harper, Ines
Cheow, Heok
Hoopen, Rogier ten
Pitfield, Deborah
Gallagher, Ferdia A.
Attili, Bala
McLean, Mary
Jones, Robin L.
Dileo, Palma
Bulusu, Venkata Ramesh
Maher, Eamonn R.
Casey, Ruth T.
author_sort Aloj, Luigi
collection PubMed
description BACKGROUND: [(68) Ga]Ga-DOTATATE PET/CT is now recognised as the most sensitive functional imaging modality for the diagnosis of well-differentiated neuroendocrine tumours (NET) and can inform treatment with peptide receptor radionuclide therapy with [(177)Lu]Lu-DOTATATE. However, somatostatin receptor (SSTR) expression is not unique to NET, and therefore, [(68) Ga]Ga-DOTATATE PET/CT may have oncological application in other tumours. Molecular profiling of gastrointestinal stromal tumours that lack activating somatic mutations in KIT or PDGFRA or so-called ‘wild-type’ GIST (wtGIST) has demonstrated that wtGIST and NET have overlapping molecular features and has encouraged exploration of shared therapeutic targets, due to a lack of effective therapies currently available for metastatic wtGIST. AIMS: To investigate (i) the diagnostic role of [(68) Ga]Ga-DOTATATE PET/CT; and, (ii) to investigate the potential of this imaging modality to guide treatment with [(177)Lu]Lu-DOTATATE in patients with wtGIST. METHODS: [(68) Ga]Ga-DOTATATE PET/CT was performed on 11 patients with confirmed or metastatic wtGIST and one patient with a history of wtGIST and a mediastinal mass suspicious for metastatic wtGIST, who was subsequently diagnosed with a metachronous mediastinal paraganglioma. Tumour expression of somatostatin receptor subtype 2 (SSTR2) using immunohistochemistry was performed on 54 tumour samples including samples from 8/12 (66.6%) patients who took part in the imaging study and 46 tumour samples from individuals not included in the imaging study. RESULTS: [(68) Ga]Ga-DOTATATE PET/CT imaging was negative, demonstrating that liver metastases had lower uptake than background liver for nine cases (9/12 cases, 75%) and heterogeneous uptake of somatostatin tracer was noted for two cases (16.6%) of wtGIST. However, [(68) Ga]Ga-DOTATATE PET/CT demonstrated intense tracer uptake in a synchronous paraganglioma in one case and a metachronous paraganglioma in another case with wtGIST. CONCLUSIONS: Our data suggest that SSTR2 is not a diagnostic or therapeutic target in wtGIST. [(68) Ga]Ga-DOTATATE PET/CT may have specific diagnostic utility in differentiating wtGIST from other primary tumours such as paraganglioma in patients with sporadic and hereditary forms of wtGIST.
format Online
Article
Text
id pubmed-7809083
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Springer Berlin Heidelberg
record_format MEDLINE/PubMed
spelling pubmed-78090832021-01-21 The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST) Aloj, Luigi Giger, Olivier Mendichovszky, Iosif A. Challis, Ben G. Ronel, Meytar Harper, Ines Cheow, Heok Hoopen, Rogier ten Pitfield, Deborah Gallagher, Ferdia A. Attili, Bala McLean, Mary Jones, Robin L. Dileo, Palma Bulusu, Venkata Ramesh Maher, Eamonn R. Casey, Ruth T. EJNMMI Res Original Research BACKGROUND: [(68) Ga]Ga-DOTATATE PET/CT is now recognised as the most sensitive functional imaging modality for the diagnosis of well-differentiated neuroendocrine tumours (NET) and can inform treatment with peptide receptor radionuclide therapy with [(177)Lu]Lu-DOTATATE. However, somatostatin receptor (SSTR) expression is not unique to NET, and therefore, [(68) Ga]Ga-DOTATATE PET/CT may have oncological application in other tumours. Molecular profiling of gastrointestinal stromal tumours that lack activating somatic mutations in KIT or PDGFRA or so-called ‘wild-type’ GIST (wtGIST) has demonstrated that wtGIST and NET have overlapping molecular features and has encouraged exploration of shared therapeutic targets, due to a lack of effective therapies currently available for metastatic wtGIST. AIMS: To investigate (i) the diagnostic role of [(68) Ga]Ga-DOTATATE PET/CT; and, (ii) to investigate the potential of this imaging modality to guide treatment with [(177)Lu]Lu-DOTATATE in patients with wtGIST. METHODS: [(68) Ga]Ga-DOTATATE PET/CT was performed on 11 patients with confirmed or metastatic wtGIST and one patient with a history of wtGIST and a mediastinal mass suspicious for metastatic wtGIST, who was subsequently diagnosed with a metachronous mediastinal paraganglioma. Tumour expression of somatostatin receptor subtype 2 (SSTR2) using immunohistochemistry was performed on 54 tumour samples including samples from 8/12 (66.6%) patients who took part in the imaging study and 46 tumour samples from individuals not included in the imaging study. RESULTS: [(68) Ga]Ga-DOTATATE PET/CT imaging was negative, demonstrating that liver metastases had lower uptake than background liver for nine cases (9/12 cases, 75%) and heterogeneous uptake of somatostatin tracer was noted for two cases (16.6%) of wtGIST. However, [(68) Ga]Ga-DOTATATE PET/CT demonstrated intense tracer uptake in a synchronous paraganglioma in one case and a metachronous paraganglioma in another case with wtGIST. CONCLUSIONS: Our data suggest that SSTR2 is not a diagnostic or therapeutic target in wtGIST. [(68) Ga]Ga-DOTATATE PET/CT may have specific diagnostic utility in differentiating wtGIST from other primary tumours such as paraganglioma in patients with sporadic and hereditary forms of wtGIST. Springer Berlin Heidelberg 2021-01-14 /pmc/articles/PMC7809083/ /pubmed/33443647 http://dx.doi.org/10.1186/s13550-021-00747-0 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Original Research
Aloj, Luigi
Giger, Olivier
Mendichovszky, Iosif A.
Challis, Ben G.
Ronel, Meytar
Harper, Ines
Cheow, Heok
Hoopen, Rogier ten
Pitfield, Deborah
Gallagher, Ferdia A.
Attili, Bala
McLean, Mary
Jones, Robin L.
Dileo, Palma
Bulusu, Venkata Ramesh
Maher, Eamonn R.
Casey, Ruth T.
The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title_full The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title_fullStr The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title_full_unstemmed The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title_short The role of [(68) Ga]Ga-DOTATATE PET/CT in wild-type KIT/PDGFRA gastrointestinal stromal tumours (GIST)
title_sort role of [(68) ga]ga-dotatate pet/ct in wild-type kit/pdgfra gastrointestinal stromal tumours (gist)
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7809083/
https://www.ncbi.nlm.nih.gov/pubmed/33443647
http://dx.doi.org/10.1186/s13550-021-00747-0
work_keys_str_mv AT alojluigi theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT gigerolivier theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mendichovszkyiosifa theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT challisbeng theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT ronelmeytar theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT harperines theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT cheowheok theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT hoopenrogierten theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT pitfielddeborah theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT gallagherferdiaa theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT attilibala theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mcleanmary theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT jonesrobinl theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT dileopalma theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT bulusuvenkataramesh theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mahereamonnr theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT caseyrutht theroleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT alojluigi roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT gigerolivier roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mendichovszkyiosifa roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT challisbeng roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT ronelmeytar roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT harperines roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT cheowheok roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT hoopenrogierten roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT pitfielddeborah roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT gallagherferdiaa roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT attilibala roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mcleanmary roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT jonesrobinl roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT dileopalma roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT bulusuvenkataramesh roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT mahereamonnr roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist
AT caseyrutht roleof68gagadotatatepetctinwildtypekitpdgfragastrointestinalstromaltumoursgist