Cargando…

Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion

The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury i...

Descripción completa

Detalles Bibliográficos
Autores principales: Sun, Qian, Zeng, Cheng, Du, Li, Dong, Chong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7812573/
https://www.ncbi.nlm.nih.gov/pubmed/33488799
http://dx.doi.org/10.3892/etm.2021.9622
_version_ 1783637698382135296
author Sun, Qian
Zeng, Cheng
Du, Li
Dong, Chong
author_facet Sun, Qian
Zeng, Cheng
Du, Li
Dong, Chong
author_sort Sun, Qian
collection PubMed
description The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury is incompletely understood. A rat model of renal IR was established by occlusion of the bilateral renal pedicle for 45 min, followed by reperfusion for 24 h. Renal injury was assessed by light microscopy and levels of serum creatinine, blood urea nitrogen and neutrophil gelatinase-associated lipocalin was measured using enzyme-linked immunosorbent assay. Renal oxidative stress was also evaluated by measuring superoxide dismutase and malondialdehyde in renal tissues. Protein expression levels of brain and muscle ARNT-like 1 (BMAL1), nuclear factor erythroid 2-related factor 2 (NRF2), NAD(P)H dehydrogenase [quinone] 1 (NQO1), glutamate-cysteine ligase modifier (GCLM) and heme oxygenase 1 (HO1) in the kidney were determined by western blotting and immunohistochemistry. Reverse transcription-quantitative PCR was used to evaluate rhythmic transcription of the core clock genes (CLOCK and BMAL1) and the NRF2 gene. The nature of the binding of BMAL1 to the promoter regions in the NRF2 gene was assessed by chromatin immunoprecipitation assays in rat kidneys. BMAL1 was found to bind to the promoter of the NRF2 gene through an E-BOX element associated with strongly rhythmic activation of NRF2 in both the normal kidney and those exposed to IR. The ARE-regulated anti-oxidative stress protein was affected by the circadian rhythm of the NRF2 gene. As the NRF2 level was at a circadian nadir, the expression of the proteins NQO1, GCLM and HO1 was weakened, resulting in more serious renal oxidative stress injury and pathological and functional impairment induced by IR. It can be concluded that the circadian rhythm of the NRF2/ARE pathway controlled by the circadian clock is essential for regulating antioxidant stress in renal IR injury, which might prompt new therapeutic strategies associated with the diurnal variability of human kidney disease, including renal transplantation.
format Online
Article
Text
id pubmed-7812573
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-78125732021-01-22 Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion Sun, Qian Zeng, Cheng Du, Li Dong, Chong Exp Ther Med Articles The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury is incompletely understood. A rat model of renal IR was established by occlusion of the bilateral renal pedicle for 45 min, followed by reperfusion for 24 h. Renal injury was assessed by light microscopy and levels of serum creatinine, blood urea nitrogen and neutrophil gelatinase-associated lipocalin was measured using enzyme-linked immunosorbent assay. Renal oxidative stress was also evaluated by measuring superoxide dismutase and malondialdehyde in renal tissues. Protein expression levels of brain and muscle ARNT-like 1 (BMAL1), nuclear factor erythroid 2-related factor 2 (NRF2), NAD(P)H dehydrogenase [quinone] 1 (NQO1), glutamate-cysteine ligase modifier (GCLM) and heme oxygenase 1 (HO1) in the kidney were determined by western blotting and immunohistochemistry. Reverse transcription-quantitative PCR was used to evaluate rhythmic transcription of the core clock genes (CLOCK and BMAL1) and the NRF2 gene. The nature of the binding of BMAL1 to the promoter regions in the NRF2 gene was assessed by chromatin immunoprecipitation assays in rat kidneys. BMAL1 was found to bind to the promoter of the NRF2 gene through an E-BOX element associated with strongly rhythmic activation of NRF2 in both the normal kidney and those exposed to IR. The ARE-regulated anti-oxidative stress protein was affected by the circadian rhythm of the NRF2 gene. As the NRF2 level was at a circadian nadir, the expression of the proteins NQO1, GCLM and HO1 was weakened, resulting in more serious renal oxidative stress injury and pathological and functional impairment induced by IR. It can be concluded that the circadian rhythm of the NRF2/ARE pathway controlled by the circadian clock is essential for regulating antioxidant stress in renal IR injury, which might prompt new therapeutic strategies associated with the diurnal variability of human kidney disease, including renal transplantation. D.A. Spandidos 2021-03 2021-01-07 /pmc/articles/PMC7812573/ /pubmed/33488799 http://dx.doi.org/10.3892/etm.2021.9622 Text en Copyright © Sun et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made.
spellingShingle Articles
Sun, Qian
Zeng, Cheng
Du, Li
Dong, Chong
Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title_full Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title_fullStr Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title_full_unstemmed Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title_short Mechanism of circadian regulation of the NRF2/ARE pathway in renal ischemia-reperfusion
title_sort mechanism of circadian regulation of the nrf2/are pathway in renal ischemia-reperfusion
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7812573/
https://www.ncbi.nlm.nih.gov/pubmed/33488799
http://dx.doi.org/10.3892/etm.2021.9622
work_keys_str_mv AT sunqian mechanismofcircadianregulationofthenrf2arepathwayinrenalischemiareperfusion
AT zengcheng mechanismofcircadianregulationofthenrf2arepathwayinrenalischemiareperfusion
AT duli mechanismofcircadianregulationofthenrf2arepathwayinrenalischemiareperfusion
AT dongchong mechanismofcircadianregulationofthenrf2arepathwayinrenalischemiareperfusion