Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway

Detalles Bibliográficos
Autores principales: Liu, Pengcheng, Du, Ruili, Yu, Xin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: International Scientific Literature, Inc. 2021
Materias:
Retraction Note
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7817087/
https://www.ncbi.nlm.nih.gov/pubmed/33452230
http://dx.doi.org/10.12659/MSM.930758
_version_ 1783638573046562816
author Liu, Pengcheng
Du, Ruili
Yu, Xin
author_facet Liu, Pengcheng
Du, Ruili
Yu, Xin
author_sort Liu, Pengcheng
collection PubMed
description
format Online
Article
Text
id pubmed-7817087
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher International Scientific Literature, Inc.
record_format MEDLINE/PubMed
spelling pubmed-78170872021-01-22 Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway Liu, Pengcheng Du, Ruili Yu, Xin Med Sci Monit Retraction Note International Scientific Literature, Inc. 2021-01-16 /pmc/articles/PMC7817087/ /pubmed/33452230 http://dx.doi.org/10.12659/MSM.930758 Text en © Med Sci Monit, 2021 This work is licensed under Creative Common Attribution-NonCommercial-NoDerivatives 4.0 International (CC BY-NC-ND 4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) )
spellingShingle Retraction Note
Liu, Pengcheng
Du, Ruili
Yu, Xin
Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title_full Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title_fullStr Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title_full_unstemmed Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title_short Retracted: Ursolic Acid Exhibits Potent Anticancer Effects in Human Metastatic Melanoma Cancer Cells (SK-MEL-24) via Apoptosis Induction, Inhibition of Cell Migration and Invasion, Cell Cycle Arrest, and Inhibition of Mitogen-Activated Protein Kinase (MAPK)/ERK Signaling Pathway
title_sort retracted: ursolic acid exhibits potent anticancer effects in human metastatic melanoma cancer cells (sk-mel-24) via apoptosis induction, inhibition of cell migration and invasion, cell cycle arrest, and inhibition of mitogen-activated protein kinase (mapk)/erk signaling pathway
topic Retraction Note
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7817087/
https://www.ncbi.nlm.nih.gov/pubmed/33452230
http://dx.doi.org/10.12659/MSM.930758
work_keys_str_mv AT liupengcheng retractedursolicacidexhibitspotentanticancereffectsinhumanmetastaticmelanomacancercellsskmel24viaapoptosisinductioninhibitionofcellmigrationandinvasioncellcyclearrestandinhibitionofmitogenactivatedproteinkinasemapkerksignalingpathway
AT duruili retractedursolicacidexhibitspotentanticancereffectsinhumanmetastaticmelanomacancercellsskmel24viaapoptosisinductioninhibitionofcellmigrationandinvasioncellcyclearrestandinhibitionofmitogenactivatedproteinkinasemapkerksignalingpathway
AT yuxin retractedursolicacidexhibitspotentanticancereffectsinhumanmetastaticmelanomacancercellsskmel24viaapoptosisinductioninhibitionofcellmigrationandinvasioncellcyclearrestandinhibitionofmitogenactivatedproteinkinasemapkerksignalingpathway

Ejemplares similares