Cargando…
Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review
AIM: To assess the effect of periodontal treatment (PT) on glomerular filtration rate (GFR), systemic inflammation, or mortality in patients with chronic kidney disease (CKD). METHODS: A literature search was performed on PubMed and Web of Science databases on articles published until December 2019....
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822280/ https://www.ncbi.nlm.nih.gov/pubmed/33481920 http://dx.doi.org/10.1371/journal.pone.0245619 |
_version_ | 1783639597872316416 |
---|---|
author | Delbove, Théo Gueyffier, François Juillard, Laurent Kalbacher, Emilie Maucort-Boulch, Delphine Nony, Patrice Grosgogeat, Brigitte Gritsch, Kerstin |
author_facet | Delbove, Théo Gueyffier, François Juillard, Laurent Kalbacher, Emilie Maucort-Boulch, Delphine Nony, Patrice Grosgogeat, Brigitte Gritsch, Kerstin |
author_sort | Delbove, Théo |
collection | PubMed |
description | AIM: To assess the effect of periodontal treatment (PT) on glomerular filtration rate (GFR), systemic inflammation, or mortality in patients with chronic kidney disease (CKD). METHODS: A literature search was performed on PubMed and Web of Science databases on articles published until December 2019. The PRISMA guidelines were used throughout the manuscript. RESULTS: Of the total studies found, only 18 met the inclusion criteria; four retrospective and 14 prospective studies (including 3 randomized controlled trials–RCT). After PT, 3 studies investigated GFR, 2 found significant improvement; 11 (including 2 RCTs) investigated C-reactive protein levels, 9 found a significant improvement (including the 2 RCTs); 5 (including 3 RCTs) investigated Interleukine-6 level, 4 found a significant improvement (including 2 RCTs) and 2 studies evaluated mortality, one (retrospective study) found a significant difference. CONCLUSIONS: Within the limitations of the present study, PT seems to improve CKD status, especially by reducing the systemic inflammation. Further RCTs are needed to confirm the results and specifically assess the influence of different types of PT in CKD patients. Taking into consideration the ability of PT to prevent further tooth loss and denutrition, early management of periodontitis is extremely important in patients with impaired renal function. |
format | Online Article Text |
id | pubmed-7822280 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-78222802021-01-29 Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review Delbove, Théo Gueyffier, François Juillard, Laurent Kalbacher, Emilie Maucort-Boulch, Delphine Nony, Patrice Grosgogeat, Brigitte Gritsch, Kerstin PLoS One Research Article AIM: To assess the effect of periodontal treatment (PT) on glomerular filtration rate (GFR), systemic inflammation, or mortality in patients with chronic kidney disease (CKD). METHODS: A literature search was performed on PubMed and Web of Science databases on articles published until December 2019. The PRISMA guidelines were used throughout the manuscript. RESULTS: Of the total studies found, only 18 met the inclusion criteria; four retrospective and 14 prospective studies (including 3 randomized controlled trials–RCT). After PT, 3 studies investigated GFR, 2 found significant improvement; 11 (including 2 RCTs) investigated C-reactive protein levels, 9 found a significant improvement (including the 2 RCTs); 5 (including 3 RCTs) investigated Interleukine-6 level, 4 found a significant improvement (including 2 RCTs) and 2 studies evaluated mortality, one (retrospective study) found a significant difference. CONCLUSIONS: Within the limitations of the present study, PT seems to improve CKD status, especially by reducing the systemic inflammation. Further RCTs are needed to confirm the results and specifically assess the influence of different types of PT in CKD patients. Taking into consideration the ability of PT to prevent further tooth loss and denutrition, early management of periodontitis is extremely important in patients with impaired renal function. Public Library of Science 2021-01-22 /pmc/articles/PMC7822280/ /pubmed/33481920 http://dx.doi.org/10.1371/journal.pone.0245619 Text en © 2021 Delbove et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Delbove, Théo Gueyffier, François Juillard, Laurent Kalbacher, Emilie Maucort-Boulch, Delphine Nony, Patrice Grosgogeat, Brigitte Gritsch, Kerstin Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title | Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title_full | Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title_fullStr | Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title_full_unstemmed | Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title_short | Effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: A systematic review |
title_sort | effect of periodontal treatment on the glomerular filtration rate, reduction of inflammatory markers and mortality in patients with chronic kidney disease: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822280/ https://www.ncbi.nlm.nih.gov/pubmed/33481920 http://dx.doi.org/10.1371/journal.pone.0245619 |
work_keys_str_mv | AT delbovetheo effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT gueyffierfrancois effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT juillardlaurent effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT kalbacheremilie effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT maucortboulchdelphine effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT nonypatrice effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT grosgogeatbrigitte effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview AT gritschkerstin effectofperiodontaltreatmentontheglomerularfiltrationratereductionofinflammatorymarkersandmortalityinpatientswithchronickidneydiseaseasystematicreview |