Cargando…

The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles

In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effect...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhao, Peikun, Song, Zidai, Wang, Yan, Cai, Han, Du, Xiaoyan, Li, Changlong, Lv, Jianyi, Liu, Xin, Guo, Meng, Chen, Zhenwen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7835019/
https://www.ncbi.nlm.nih.gov/pubmed/33291075
http://dx.doi.org/10.18632/aging.202235
_version_ 1783642421073018880
author Zhao, Peikun
Song, Zidai
Wang, Yan
Cai, Han
Du, Xiaoyan
Li, Changlong
Lv, Jianyi
Liu, Xin
Guo, Meng
Chen, Zhenwen
author_facet Zhao, Peikun
Song, Zidai
Wang, Yan
Cai, Han
Du, Xiaoyan
Li, Changlong
Lv, Jianyi
Liu, Xin
Guo, Meng
Chen, Zhenwen
author_sort Zhao, Peikun
collection PubMed
description In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effectors, cyclic guanosine monophosphate (cGMP) and cGMP-dependent protein kinase G (PKG), were expressed in pre-granulosa cells and promoted primordial follicle activation, oocyte growth and granulosa cell proliferation in neonatal ovaries. Mammalian target of rapamycin (mTOR) colocalized with PKG in pre-granulosa cells and was essential for eNOS/cGMP/PKG pathway-induced primordial follicle activation. The eNOS/cGMP/PKG pathway was found to stabilize mTOR protein. The mRNA levels of F-box and WD repeat domain containing 7 (FBXW7), an E3 ubiquitin ligase, correlated negatively with mTOR protein levels in neonatal ovaries. FBXW7 bound to and destabilized mTOR protein in pre-granulosa cells in a ubiquitin/proteasome-dependent manner. However, agonists of the eNOS/cGMP/PKG pathway reduced FBXW7 mRNA levels. FBXW7 overexpression suppressed primordial follicle activation and prevented the eNOS/cGMP/PKG pathway from activating primordial follicles and stabilizing mTOR protein. These findings demonstrate that the eNOS/cGMP/PKG pathway activates primordial follicles by suppressing FBXW7-induced ubiquitination of mTOR in mice.
format Online
Article
Text
id pubmed-7835019
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Impact Journals
record_format MEDLINE/PubMed
spelling pubmed-78350192021-02-03 The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles Zhao, Peikun Song, Zidai Wang, Yan Cai, Han Du, Xiaoyan Li, Changlong Lv, Jianyi Liu, Xin Guo, Meng Chen, Zhenwen Aging (Albany NY) Research Paper In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effectors, cyclic guanosine monophosphate (cGMP) and cGMP-dependent protein kinase G (PKG), were expressed in pre-granulosa cells and promoted primordial follicle activation, oocyte growth and granulosa cell proliferation in neonatal ovaries. Mammalian target of rapamycin (mTOR) colocalized with PKG in pre-granulosa cells and was essential for eNOS/cGMP/PKG pathway-induced primordial follicle activation. The eNOS/cGMP/PKG pathway was found to stabilize mTOR protein. The mRNA levels of F-box and WD repeat domain containing 7 (FBXW7), an E3 ubiquitin ligase, correlated negatively with mTOR protein levels in neonatal ovaries. FBXW7 bound to and destabilized mTOR protein in pre-granulosa cells in a ubiquitin/proteasome-dependent manner. However, agonists of the eNOS/cGMP/PKG pathway reduced FBXW7 mRNA levels. FBXW7 overexpression suppressed primordial follicle activation and prevented the eNOS/cGMP/PKG pathway from activating primordial follicles and stabilizing mTOR protein. These findings demonstrate that the eNOS/cGMP/PKG pathway activates primordial follicles by suppressing FBXW7-induced ubiquitination of mTOR in mice. Impact Journals 2020-12-03 /pmc/articles/PMC7835019/ /pubmed/33291075 http://dx.doi.org/10.18632/aging.202235 Text en Copyright: © 2020 Zhao et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/3.0/) (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Paper
Zhao, Peikun
Song, Zidai
Wang, Yan
Cai, Han
Du, Xiaoyan
Li, Changlong
Lv, Jianyi
Liu, Xin
Guo, Meng
Chen, Zhenwen
The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title_full The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title_fullStr The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title_full_unstemmed The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title_short The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
title_sort endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase g pathway activates primordial follicles
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7835019/
https://www.ncbi.nlm.nih.gov/pubmed/33291075
http://dx.doi.org/10.18632/aging.202235
work_keys_str_mv AT zhaopeikun theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT songzidai theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT wangyan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT caihan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT duxiaoyan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT lichanglong theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT lvjianyi theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT liuxin theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT guomeng theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT chenzhenwen theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT zhaopeikun endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT songzidai endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT wangyan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT caihan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT duxiaoyan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT lichanglong endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT lvjianyi endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT liuxin endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT guomeng endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles
AT chenzhenwen endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles