Cargando…
The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles
In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effect...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7835019/ https://www.ncbi.nlm.nih.gov/pubmed/33291075 http://dx.doi.org/10.18632/aging.202235 |
_version_ | 1783642421073018880 |
---|---|
author | Zhao, Peikun Song, Zidai Wang, Yan Cai, Han Du, Xiaoyan Li, Changlong Lv, Jianyi Liu, Xin Guo, Meng Chen, Zhenwen |
author_facet | Zhao, Peikun Song, Zidai Wang, Yan Cai, Han Du, Xiaoyan Li, Changlong Lv, Jianyi Liu, Xin Guo, Meng Chen, Zhenwen |
author_sort | Zhao, Peikun |
collection | PubMed |
description | In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effectors, cyclic guanosine monophosphate (cGMP) and cGMP-dependent protein kinase G (PKG), were expressed in pre-granulosa cells and promoted primordial follicle activation, oocyte growth and granulosa cell proliferation in neonatal ovaries. Mammalian target of rapamycin (mTOR) colocalized with PKG in pre-granulosa cells and was essential for eNOS/cGMP/PKG pathway-induced primordial follicle activation. The eNOS/cGMP/PKG pathway was found to stabilize mTOR protein. The mRNA levels of F-box and WD repeat domain containing 7 (FBXW7), an E3 ubiquitin ligase, correlated negatively with mTOR protein levels in neonatal ovaries. FBXW7 bound to and destabilized mTOR protein in pre-granulosa cells in a ubiquitin/proteasome-dependent manner. However, agonists of the eNOS/cGMP/PKG pathway reduced FBXW7 mRNA levels. FBXW7 overexpression suppressed primordial follicle activation and prevented the eNOS/cGMP/PKG pathway from activating primordial follicles and stabilizing mTOR protein. These findings demonstrate that the eNOS/cGMP/PKG pathway activates primordial follicles by suppressing FBXW7-induced ubiquitination of mTOR in mice. |
format | Online Article Text |
id | pubmed-7835019 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Impact Journals |
record_format | MEDLINE/PubMed |
spelling | pubmed-78350192021-02-03 The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles Zhao, Peikun Song, Zidai Wang, Yan Cai, Han Du, Xiaoyan Li, Changlong Lv, Jianyi Liu, Xin Guo, Meng Chen, Zhenwen Aging (Albany NY) Research Paper In mammals, the well-organized activation of quiescent primordial follicles is pivotal for female reproductive reserve. In the present study, we examined the mechanisms underlying primordial follicle activation in mice. We found that endothelial nitric oxide synthase (eNOS) and its downstream effectors, cyclic guanosine monophosphate (cGMP) and cGMP-dependent protein kinase G (PKG), were expressed in pre-granulosa cells and promoted primordial follicle activation, oocyte growth and granulosa cell proliferation in neonatal ovaries. Mammalian target of rapamycin (mTOR) colocalized with PKG in pre-granulosa cells and was essential for eNOS/cGMP/PKG pathway-induced primordial follicle activation. The eNOS/cGMP/PKG pathway was found to stabilize mTOR protein. The mRNA levels of F-box and WD repeat domain containing 7 (FBXW7), an E3 ubiquitin ligase, correlated negatively with mTOR protein levels in neonatal ovaries. FBXW7 bound to and destabilized mTOR protein in pre-granulosa cells in a ubiquitin/proteasome-dependent manner. However, agonists of the eNOS/cGMP/PKG pathway reduced FBXW7 mRNA levels. FBXW7 overexpression suppressed primordial follicle activation and prevented the eNOS/cGMP/PKG pathway from activating primordial follicles and stabilizing mTOR protein. These findings demonstrate that the eNOS/cGMP/PKG pathway activates primordial follicles by suppressing FBXW7-induced ubiquitination of mTOR in mice. Impact Journals 2020-12-03 /pmc/articles/PMC7835019/ /pubmed/33291075 http://dx.doi.org/10.18632/aging.202235 Text en Copyright: © 2020 Zhao et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/3.0/) (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Zhao, Peikun Song, Zidai Wang, Yan Cai, Han Du, Xiaoyan Li, Changlong Lv, Jianyi Liu, Xin Guo, Meng Chen, Zhenwen The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title | The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title_full | The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title_fullStr | The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title_full_unstemmed | The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title_short | The endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase G pathway activates primordial follicles |
title_sort | endothelial nitric oxide synthase/cyclic guanosine monophosphate/protein kinase g pathway activates primordial follicles |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7835019/ https://www.ncbi.nlm.nih.gov/pubmed/33291075 http://dx.doi.org/10.18632/aging.202235 |
work_keys_str_mv | AT zhaopeikun theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT songzidai theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT wangyan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT caihan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT duxiaoyan theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT lichanglong theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT lvjianyi theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT liuxin theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT guomeng theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT chenzhenwen theendothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT zhaopeikun endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT songzidai endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT wangyan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT caihan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT duxiaoyan endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT lichanglong endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT lvjianyi endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT liuxin endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT guomeng endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles AT chenzhenwen endothelialnitricoxidesynthasecyclicguanosinemonophosphateproteinkinasegpathwayactivatesprimordialfollicles |