COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA

Residents of long-term care facilities are at risk for coronavirus disease. We report a surveillance exercise at such a facility in Pennsylvania, USA. After introduction of a testing strategy and other measures, this facility had a 17-fold lower coronavirus disease case rate than neighboring facilit...

Descripción completa

Detalles Bibliográficos
Autores principales: Shimotsu, Scott T., Johnson, Ariel R.L., Berke, Ethan M., Griffin, Daniel O.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Centers for Disease Control and Prevention 2021
Materias:
Research Letter
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7853559/
https://www.ncbi.nlm.nih.gov/pubmed/33211994
http://dx.doi.org/10.3201/eid2702.204265
_version_ 1783645987367026688
author Shimotsu, Scott T.
Johnson, Ariel R.L.
Berke, Ethan M.
Griffin, Daniel O.
author_facet Shimotsu, Scott T.
Johnson, Ariel R.L.
Berke, Ethan M.
Griffin, Daniel O.
author_sort Shimotsu, Scott T.
collection PubMed
description Residents of long-term care facilities are at risk for coronavirus disease. We report a surveillance exercise at such a facility in Pennsylvania, USA. After introduction of a testing strategy and other measures, this facility had a 17-fold lower coronavirus disease case rate than neighboring facilities.
format Online
Article
Text
id pubmed-7853559
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Centers for Disease Control and Prevention
record_format MEDLINE/PubMed
spelling pubmed-78535592021-02-09 COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA Shimotsu, Scott T. Johnson, Ariel R.L. Berke, Ethan M. Griffin, Daniel O. Emerg Infect Dis Research Letter Residents of long-term care facilities are at risk for coronavirus disease. We report a surveillance exercise at such a facility in Pennsylvania, USA. After introduction of a testing strategy and other measures, this facility had a 17-fold lower coronavirus disease case rate than neighboring facilities. Centers for Disease Control and Prevention 2021-02 /pmc/articles/PMC7853559/ /pubmed/33211994 http://dx.doi.org/10.3201/eid2702.204265 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited.
spellingShingle Research Letter
Shimotsu, Scott T.
Johnson, Ariel R.L.
Berke, Ethan M.
Griffin, Daniel O.
COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title_full COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title_fullStr COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title_full_unstemmed COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title_short COVID-19 Infection Control Measures in Long-Term Care Facility, Pennsylvania, USA
title_sort covid-19 infection control measures in long-term care facility, pennsylvania, usa
topic Research Letter
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7853559/
https://www.ncbi.nlm.nih.gov/pubmed/33211994
http://dx.doi.org/10.3201/eid2702.204265
work_keys_str_mv AT shimotsuscottt covid19infectioncontrolmeasuresinlongtermcarefacilitypennsylvaniausa
AT johnsonarielrl covid19infectioncontrolmeasuresinlongtermcarefacilitypennsylvaniausa
AT berkeethanm covid19infectioncontrolmeasuresinlongtermcarefacilitypennsylvaniausa
AT griffindanielo covid19infectioncontrolmeasuresinlongtermcarefacilitypennsylvaniausa

Ejemplares similares