Cargando…
INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review
BACKGROUND: Heterozygous mutations in the inverted formin 2 (INF2) gene are related to secondary focal segmental glomerulosclerosis (FSGS), a rare secondary disease associated with rapidly progressive renal failure. CASE PRESENTATION: We report a patient with familial autosomal INF2 mutation manifes...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7863463/ https://www.ncbi.nlm.nih.gov/pubmed/33541266 http://dx.doi.org/10.1186/s12882-021-02254-9 |
_version_ | 1783647499495407616 |
---|---|
author | Zhao, Wenbo Ma, Xinxin Zhang, Xiaohao Luo, Dan Zhang, Jun Li, Ming Ye, Zengchun Peng, Hui |
author_facet | Zhao, Wenbo Ma, Xinxin Zhang, Xiaohao Luo, Dan Zhang, Jun Li, Ming Ye, Zengchun Peng, Hui |
author_sort | Zhao, Wenbo |
collection | PubMed |
description | BACKGROUND: Heterozygous mutations in the inverted formin 2 (INF2) gene are related to secondary focal segmental glomerulosclerosis (FSGS), a rare secondary disease associated with rapidly progressive renal failure. CASE PRESENTATION: We report a patient with familial autosomal INF2 mutation manifesting nephritic syndromes and elevated serum creatinine levels. Mutational analysis revealed an autosomal dominant (AD) inheritance pattern and a mutation in exon 4 (p.Arg214Cys) of INF2 as the likely cause, which has not been previously described in an Asian family. The patient progressed to end-stage renal disease (ESRD) and received hemodialysis. His mother had undergone renal transplant 3 years earlier, and his grandmother had carried the p.Arg214Cys mutation for more than 80 years without any sign of renal dysfunction. CONCLUSIONS: This is the first report to identify an association between a familial autosomal dominant INF2 p.Arg214Cys mutation and rapidly progressive renal disease in an Asian family. INF2 mutation analysis should not be restricted to individuals without family history of FSGS, rather it should also be performed on individuals for whom drug-based therapies are not effective. In this case, kidney transplant is an effective alternative. |
format | Online Article Text |
id | pubmed-7863463 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-78634632021-02-05 INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review Zhao, Wenbo Ma, Xinxin Zhang, Xiaohao Luo, Dan Zhang, Jun Li, Ming Ye, Zengchun Peng, Hui BMC Nephrol Case Report BACKGROUND: Heterozygous mutations in the inverted formin 2 (INF2) gene are related to secondary focal segmental glomerulosclerosis (FSGS), a rare secondary disease associated with rapidly progressive renal failure. CASE PRESENTATION: We report a patient with familial autosomal INF2 mutation manifesting nephritic syndromes and elevated serum creatinine levels. Mutational analysis revealed an autosomal dominant (AD) inheritance pattern and a mutation in exon 4 (p.Arg214Cys) of INF2 as the likely cause, which has not been previously described in an Asian family. The patient progressed to end-stage renal disease (ESRD) and received hemodialysis. His mother had undergone renal transplant 3 years earlier, and his grandmother had carried the p.Arg214Cys mutation for more than 80 years without any sign of renal dysfunction. CONCLUSIONS: This is the first report to identify an association between a familial autosomal dominant INF2 p.Arg214Cys mutation and rapidly progressive renal disease in an Asian family. INF2 mutation analysis should not be restricted to individuals without family history of FSGS, rather it should also be performed on individuals for whom drug-based therapies are not effective. In this case, kidney transplant is an effective alternative. BioMed Central 2021-02-04 /pmc/articles/PMC7863463/ /pubmed/33541266 http://dx.doi.org/10.1186/s12882-021-02254-9 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Zhao, Wenbo Ma, Xinxin Zhang, Xiaohao Luo, Dan Zhang, Jun Li, Ming Ye, Zengchun Peng, Hui INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title | INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title_full | INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title_fullStr | INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title_full_unstemmed | INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title_short | INF2 p.Arg214Cys mutation in a Chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
title_sort | inf2 p.arg214cys mutation in a chinese family with rapidly progressive renal failure and follow-up of renal transplantation: case report and literature review |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7863463/ https://www.ncbi.nlm.nih.gov/pubmed/33541266 http://dx.doi.org/10.1186/s12882-021-02254-9 |
work_keys_str_mv | AT zhaowenbo inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT maxinxin inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT zhangxiaohao inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT luodan inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT zhangjun inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT liming inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT yezengchun inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview AT penghui inf2parg214cysmutationinachinesefamilywithrapidlyprogressiverenalfailureandfollowupofrenaltransplantationcasereportandliteraturereview |