Cargando…

The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature

BACKGROUND: Sub-Saharan Africa has the highest fertility rate in the world, with the highest unmet need for family planning (FP). Yet, there is a lack of knowledge about the determinants for non-utilisation of modern contraceptive methods among women of reproductive age. This systematic review of li...

Descripción completa

Detalles Bibliográficos
Autores principales: Gahungu, Jumaine, Vahdaninia, Mariam, Regmi, Pramod R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7877117/
https://www.ncbi.nlm.nih.gov/pubmed/33568180
http://dx.doi.org/10.1186/s12978-021-01089-9
_version_ 1783650101989736448
author Gahungu, Jumaine
Vahdaninia, Mariam
Regmi, Pramod R.
author_facet Gahungu, Jumaine
Vahdaninia, Mariam
Regmi, Pramod R.
author_sort Gahungu, Jumaine
collection PubMed
description BACKGROUND: Sub-Saharan Africa has the highest fertility rate in the world, with the highest unmet need for family planning (FP). Yet, there is a lack of knowledge about the determinants for non-utilisation of modern contraceptive methods among women of reproductive age. This systematic review of literature assessed factors affecting the unmet need and reasons for non-utilisation of modern contraceptive methods during the postpartum period in Sub-Saharan African women. METHODS: An online literature search was conducted in several databases: MEDLINE, Cochrane Review, PubMed, Elsevier's Science Direct and Web of Science. The search was completed by hand searching. Data were extracted and summarised using the Arksey and O’Malley methodology. RESULTS: In total, 19 studies were included; one qualitative study, seventeen quantitative, and one used a mixed-methods approach. Studies were conducted in Ethiopia (n = 11), Nigeria (n = 3), Kenya (n = 2), Malawi (n = 2) and Uganda (n = 1). Factors affecting the unmet need for modern contraceptive methods were described at three levels: (a) individual; (b) household; and (c) healthcare facility level. Reasons for non-use of FP included: fear of side effects; husband’s disapproval; the absence of menses; abstinence; and low perception of risk of pregnancy. CONCLUSION: Unmet needs in postpartum FP in women from Sub-Saharan Africa were associated with health-system and socio-demographic determinants. We suggest that there is a need to improve the awareness of modern contraceptive methods through effective interventions. Further research is needed for under-studied countries in this continent.
format Online
Article
Text
id pubmed-7877117
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-78771172021-02-11 The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature Gahungu, Jumaine Vahdaninia, Mariam Regmi, Pramod R. Reprod Health Review BACKGROUND: Sub-Saharan Africa has the highest fertility rate in the world, with the highest unmet need for family planning (FP). Yet, there is a lack of knowledge about the determinants for non-utilisation of modern contraceptive methods among women of reproductive age. This systematic review of literature assessed factors affecting the unmet need and reasons for non-utilisation of modern contraceptive methods during the postpartum period in Sub-Saharan African women. METHODS: An online literature search was conducted in several databases: MEDLINE, Cochrane Review, PubMed, Elsevier's Science Direct and Web of Science. The search was completed by hand searching. Data were extracted and summarised using the Arksey and O’Malley methodology. RESULTS: In total, 19 studies were included; one qualitative study, seventeen quantitative, and one used a mixed-methods approach. Studies were conducted in Ethiopia (n = 11), Nigeria (n = 3), Kenya (n = 2), Malawi (n = 2) and Uganda (n = 1). Factors affecting the unmet need for modern contraceptive methods were described at three levels: (a) individual; (b) household; and (c) healthcare facility level. Reasons for non-use of FP included: fear of side effects; husband’s disapproval; the absence of menses; abstinence; and low perception of risk of pregnancy. CONCLUSION: Unmet needs in postpartum FP in women from Sub-Saharan Africa were associated with health-system and socio-demographic determinants. We suggest that there is a need to improve the awareness of modern contraceptive methods through effective interventions. Further research is needed for under-studied countries in this continent. BioMed Central 2021-02-10 /pmc/articles/PMC7877117/ /pubmed/33568180 http://dx.doi.org/10.1186/s12978-021-01089-9 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Gahungu, Jumaine
Vahdaninia, Mariam
Regmi, Pramod R.
The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title_full The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title_fullStr The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title_full_unstemmed The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title_short The unmet needs for modern family planning methods among postpartum women in Sub-Saharan Africa: a systematic review of the literature
title_sort unmet needs for modern family planning methods among postpartum women in sub-saharan africa: a systematic review of the literature
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7877117/
https://www.ncbi.nlm.nih.gov/pubmed/33568180
http://dx.doi.org/10.1186/s12978-021-01089-9
work_keys_str_mv AT gahungujumaine theunmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature
AT vahdaniniamariam theunmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature
AT regmipramodr theunmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature
AT gahungujumaine unmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature
AT vahdaniniamariam unmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature
AT regmipramodr unmetneedsformodernfamilyplanningmethodsamongpostpartumwomeninsubsaharanafricaasystematicreviewoftheliterature