Cargando…

Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism

Detalles Bibliográficos
Autores principales: Si, Lingling, Yang, Xinhui, Yan, Xinyan, Wang, Yanming, Zheng, Qiusheng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7885151/
https://www.ncbi.nlm.nih.gov/pubmed/33717265
http://dx.doi.org/10.3892/ol.2021.12529
_version_ 1783651553200046080
author Si, Lingling
Yang, Xinhui
Yan, Xinyan
Wang, Yanming
Zheng, Qiusheng
author_facet Si, Lingling
Yang, Xinhui
Yan, Xinyan
Wang, Yanming
Zheng, Qiusheng
author_sort Si, Lingling
collection PubMed
description
format Online
Article
Text
id pubmed-7885151
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-78851512021-03-12 Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism Si, Lingling Yang, Xinhui Yan, Xinyan Wang, Yanming Zheng, Qiusheng Oncol Lett Corrigendum D.A. Spandidos 2021-04 2021-02-09 /pmc/articles/PMC7885151/ /pubmed/33717265 http://dx.doi.org/10.3892/ol.2021.12529 Text en Copyright: © Si et al. This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, reproduction and adaptation in any medium and for any purpose provided that it is properly attributed. For attribution, the original author(s), title, publication source (PeerJ) and either DOI or URL of the article must be cited.
spellingShingle Corrigendum
Si, Lingling
Yang, Xinhui
Yan, Xinyan
Wang, Yanming
Zheng, Qiusheng
Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title_full Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title_fullStr Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title_full_unstemmed Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title_short Isoliquiritigenin induces apoptosis of human bladder cancer T24 cells via a cyclin-dependent kinase-independent mechanism
title_sort isoliquiritigenin induces apoptosis of human bladder cancer t24 cells via a cyclin-dependent kinase-independent mechanism
topic Corrigendum
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7885151/
https://www.ncbi.nlm.nih.gov/pubmed/33717265
http://dx.doi.org/10.3892/ol.2021.12529
work_keys_str_mv AT silingling isoliquiritigenininducesapoptosisofhumanbladdercancert24cellsviaacyclindependentkinaseindependentmechanism
AT yangxinhui isoliquiritigenininducesapoptosisofhumanbladdercancert24cellsviaacyclindependentkinaseindependentmechanism
AT yanxinyan isoliquiritigenininducesapoptosisofhumanbladdercancert24cellsviaacyclindependentkinaseindependentmechanism
AT wangyanming isoliquiritigenininducesapoptosisofhumanbladdercancert24cellsviaacyclindependentkinaseindependentmechanism
AT zhengqiusheng isoliquiritigenininducesapoptosisofhumanbladdercancert24cellsviaacyclindependentkinaseindependentmechanism