Cargando…
Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervi...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7886046/ https://www.ncbi.nlm.nih.gov/pubmed/33440071 http://dx.doi.org/10.1002/acn3.51303 |
_version_ | 1783651714356740096 |
---|---|
author | Govindan, Aparna N. Fitzpatrick, Kristin S. Manoharan, Minsha Tagge, Ian Kohama, Steven G. Ferguson, Betsy Peterson, Samuel M. Wong, Grayson S. Rooney, William D. Park, Byung Axthelm, Michael K. Bourdette, Dennis N. Sherman, Larry S. Wong, Scott W. |
author_facet | Govindan, Aparna N. Fitzpatrick, Kristin S. Manoharan, Minsha Tagge, Ian Kohama, Steven G. Ferguson, Betsy Peterson, Samuel M. Wong, Grayson S. Rooney, William D. Park, Byung Axthelm, Michael K. Bourdette, Dennis N. Sherman, Larry S. Wong, Scott W. |
author_sort | Govindan, Aparna N. |
collection | PubMed |
description | OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervical lymph nodes (LNs) and peripheral blood of Japanese macaques (JMs) with JME, and cervical LN and blood MNCs from healthy controls or animals with non‐JME conditions were analyzed for the presence of myelin‐specific T cells and changes in interleukin 17 (IL‐17) and interferon gamma (IFNγ) expression. RESULTS: Demyelinating JME lesions contained CD4(+) T cells and CD8(+) T cells specific to myelin oligodendrocyte glycoprotein (MOG), myelin basic protein (MBP), and/or proteolipid protein (PLP). CD8(+) T‐cell responses were absent in JME peripheral blood, and in age‐ and sex‐matched controls. However, CD4(+) Th1 and Th17 responses were detected in JME peripheral blood versus controls. Cervical LN MNCs from eight of nine JME animals had CD3(+) T cells specific for MOG, MBP, and PLP that were not detected in controls. Mapping myelin epitopes revealed a heterogeneity in responses among JME animals. Comparison of myelin antigen sequences with those of JM rhadinovirus (JMRV), which is found in JME lesions, identified six viral open reading frames (ORFs) with similarities to myelin antigen sequences. Overlapping peptides to these JMRV ORFs did not induce IFNγ responses. INTERPRETATIONS: JME possesses an immune‐mediated component that involves both CD4(+) and CD8(+) T cells specific for myelin antigens. JME may shed new light on inflammatory demyelinating disease pathogenesis linked to gamma‐herpesvirus infection. |
format | Online Article Text |
id | pubmed-7886046 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-78860462021-02-26 Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis Govindan, Aparna N. Fitzpatrick, Kristin S. Manoharan, Minsha Tagge, Ian Kohama, Steven G. Ferguson, Betsy Peterson, Samuel M. Wong, Grayson S. Rooney, William D. Park, Byung Axthelm, Michael K. Bourdette, Dennis N. Sherman, Larry S. Wong, Scott W. Ann Clin Transl Neurol Research Articles OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervical lymph nodes (LNs) and peripheral blood of Japanese macaques (JMs) with JME, and cervical LN and blood MNCs from healthy controls or animals with non‐JME conditions were analyzed for the presence of myelin‐specific T cells and changes in interleukin 17 (IL‐17) and interferon gamma (IFNγ) expression. RESULTS: Demyelinating JME lesions contained CD4(+) T cells and CD8(+) T cells specific to myelin oligodendrocyte glycoprotein (MOG), myelin basic protein (MBP), and/or proteolipid protein (PLP). CD8(+) T‐cell responses were absent in JME peripheral blood, and in age‐ and sex‐matched controls. However, CD4(+) Th1 and Th17 responses were detected in JME peripheral blood versus controls. Cervical LN MNCs from eight of nine JME animals had CD3(+) T cells specific for MOG, MBP, and PLP that were not detected in controls. Mapping myelin epitopes revealed a heterogeneity in responses among JME animals. Comparison of myelin antigen sequences with those of JM rhadinovirus (JMRV), which is found in JME lesions, identified six viral open reading frames (ORFs) with similarities to myelin antigen sequences. Overlapping peptides to these JMRV ORFs did not induce IFNγ responses. INTERPRETATIONS: JME possesses an immune‐mediated component that involves both CD4(+) and CD8(+) T cells specific for myelin antigens. JME may shed new light on inflammatory demyelinating disease pathogenesis linked to gamma‐herpesvirus infection. John Wiley and Sons Inc. 2021-01-13 /pmc/articles/PMC7886046/ /pubmed/33440071 http://dx.doi.org/10.1002/acn3.51303 Text en © 2021 The Authors. Annals of Clinical and Translational Neurology published by Wiley Periodicals LLC on behalf of American Neurological Association This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made. |
spellingShingle | Research Articles Govindan, Aparna N. Fitzpatrick, Kristin S. Manoharan, Minsha Tagge, Ian Kohama, Steven G. Ferguson, Betsy Peterson, Samuel M. Wong, Grayson S. Rooney, William D. Park, Byung Axthelm, Michael K. Bourdette, Dennis N. Sherman, Larry S. Wong, Scott W. Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title | Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title_full | Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title_fullStr | Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title_full_unstemmed | Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title_short | Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis |
title_sort | myelin‐specific t cells in animals with japanese macaque encephalomyelitis |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7886046/ https://www.ncbi.nlm.nih.gov/pubmed/33440071 http://dx.doi.org/10.1002/acn3.51303 |
work_keys_str_mv | AT govindanaparnan myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT fitzpatrickkristins myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT manoharanminsha myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT taggeian myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT kohamasteveng myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT fergusonbetsy myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT petersonsamuelm myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT wonggraysons myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT rooneywilliamd myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT parkbyung myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT axthelmmichaelk myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT bourdettedennisn myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT shermanlarrys myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis AT wongscottw myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis |