Cargando…

Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis

OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervi...

Descripción completa

Detalles Bibliográficos
Autores principales: Govindan, Aparna N., Fitzpatrick, Kristin S., Manoharan, Minsha, Tagge, Ian, Kohama, Steven G., Ferguson, Betsy, Peterson, Samuel M., Wong, Grayson S., Rooney, William D., Park, Byung, Axthelm, Michael K., Bourdette, Dennis N., Sherman, Larry S., Wong, Scott W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7886046/
https://www.ncbi.nlm.nih.gov/pubmed/33440071
http://dx.doi.org/10.1002/acn3.51303
_version_ 1783651714356740096
author Govindan, Aparna N.
Fitzpatrick, Kristin S.
Manoharan, Minsha
Tagge, Ian
Kohama, Steven G.
Ferguson, Betsy
Peterson, Samuel M.
Wong, Grayson S.
Rooney, William D.
Park, Byung
Axthelm, Michael K.
Bourdette, Dennis N.
Sherman, Larry S.
Wong, Scott W.
author_facet Govindan, Aparna N.
Fitzpatrick, Kristin S.
Manoharan, Minsha
Tagge, Ian
Kohama, Steven G.
Ferguson, Betsy
Peterson, Samuel M.
Wong, Grayson S.
Rooney, William D.
Park, Byung
Axthelm, Michael K.
Bourdette, Dennis N.
Sherman, Larry S.
Wong, Scott W.
author_sort Govindan, Aparna N.
collection PubMed
description OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervical lymph nodes (LNs) and peripheral blood of Japanese macaques (JMs) with JME, and cervical LN and blood MNCs from healthy controls or animals with non‐JME conditions were analyzed for the presence of myelin‐specific T cells and changes in interleukin 17 (IL‐17) and interferon gamma (IFNγ) expression. RESULTS: Demyelinating JME lesions contained CD4(+) T cells and CD8(+) T cells specific to myelin oligodendrocyte glycoprotein (MOG), myelin basic protein (MBP), and/or proteolipid protein (PLP). CD8(+) T‐cell responses were absent in JME peripheral blood, and in age‐ and sex‐matched controls. However, CD4(+) Th1 and Th17 responses were detected in JME peripheral blood versus controls. Cervical LN MNCs from eight of nine JME animals had CD3(+) T cells specific for MOG, MBP, and PLP that were not detected in controls. Mapping myelin epitopes revealed a heterogeneity in responses among JME animals. Comparison of myelin antigen sequences with those of JM rhadinovirus (JMRV), which is found in JME lesions, identified six viral open reading frames (ORFs) with similarities to myelin antigen sequences. Overlapping peptides to these JMRV ORFs did not induce IFNγ responses. INTERPRETATIONS: JME possesses an immune‐mediated component that involves both CD4(+) and CD8(+) T cells specific for myelin antigens. JME may shed new light on inflammatory demyelinating disease pathogenesis linked to gamma‐herpesvirus infection.
format Online
Article
Text
id pubmed-7886046
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-78860462021-02-26 Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis Govindan, Aparna N. Fitzpatrick, Kristin S. Manoharan, Minsha Tagge, Ian Kohama, Steven G. Ferguson, Betsy Peterson, Samuel M. Wong, Grayson S. Rooney, William D. Park, Byung Axthelm, Michael K. Bourdette, Dennis N. Sherman, Larry S. Wong, Scott W. Ann Clin Transl Neurol Research Articles OBJECTIVE: To determine whether animals with Japanese macaque encephalomyelitis (JME), a spontaneous demyelinating disease similar to multiple sclerosis (MS), harbor myelin‐specific T cells in their central nervous system (CNS) and periphery. METHODS: Mononuclear cells (MNCs) from CNS lesions, cervical lymph nodes (LNs) and peripheral blood of Japanese macaques (JMs) with JME, and cervical LN and blood MNCs from healthy controls or animals with non‐JME conditions were analyzed for the presence of myelin‐specific T cells and changes in interleukin 17 (IL‐17) and interferon gamma (IFNγ) expression. RESULTS: Demyelinating JME lesions contained CD4(+) T cells and CD8(+) T cells specific to myelin oligodendrocyte glycoprotein (MOG), myelin basic protein (MBP), and/or proteolipid protein (PLP). CD8(+) T‐cell responses were absent in JME peripheral blood, and in age‐ and sex‐matched controls. However, CD4(+) Th1 and Th17 responses were detected in JME peripheral blood versus controls. Cervical LN MNCs from eight of nine JME animals had CD3(+) T cells specific for MOG, MBP, and PLP that were not detected in controls. Mapping myelin epitopes revealed a heterogeneity in responses among JME animals. Comparison of myelin antigen sequences with those of JM rhadinovirus (JMRV), which is found in JME lesions, identified six viral open reading frames (ORFs) with similarities to myelin antigen sequences. Overlapping peptides to these JMRV ORFs did not induce IFNγ responses. INTERPRETATIONS: JME possesses an immune‐mediated component that involves both CD4(+) and CD8(+) T cells specific for myelin antigens. JME may shed new light on inflammatory demyelinating disease pathogenesis linked to gamma‐herpesvirus infection. John Wiley and Sons Inc. 2021-01-13 /pmc/articles/PMC7886046/ /pubmed/33440071 http://dx.doi.org/10.1002/acn3.51303 Text en © 2021 The Authors. Annals of Clinical and Translational Neurology published by Wiley Periodicals LLC on behalf of American Neurological Association This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made.
spellingShingle Research Articles
Govindan, Aparna N.
Fitzpatrick, Kristin S.
Manoharan, Minsha
Tagge, Ian
Kohama, Steven G.
Ferguson, Betsy
Peterson, Samuel M.
Wong, Grayson S.
Rooney, William D.
Park, Byung
Axthelm, Michael K.
Bourdette, Dennis N.
Sherman, Larry S.
Wong, Scott W.
Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title_full Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title_fullStr Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title_full_unstemmed Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title_short Myelin‐specific T cells in animals with Japanese macaque encephalomyelitis
title_sort myelin‐specific t cells in animals with japanese macaque encephalomyelitis
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7886046/
https://www.ncbi.nlm.nih.gov/pubmed/33440071
http://dx.doi.org/10.1002/acn3.51303
work_keys_str_mv AT govindanaparnan myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT fitzpatrickkristins myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT manoharanminsha myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT taggeian myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT kohamasteveng myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT fergusonbetsy myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT petersonsamuelm myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT wonggraysons myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT rooneywilliamd myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT parkbyung myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT axthelmmichaelk myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT bourdettedennisn myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT shermanlarrys myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis
AT wongscottw myelinspecifictcellsinanimalswithjapanesemacaqueencephalomyelitis