Cargando…

Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients

Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of a 50-year...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Yanfei, Gao, qiqi, Jin, Yangyi, Qi, Mengdie, Lu, Guohua, HequanLi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7889926/
https://www.ncbi.nlm.nih.gov/pubmed/33597608
http://dx.doi.org/10.1038/s41598-021-83470-z
_version_ 1783652404835647488
author Yang, Yanfei
Gao, qiqi
Jin, Yangyi
Qi, Mengdie
Lu, Guohua
HequanLi
author_facet Yang, Yanfei
Gao, qiqi
Jin, Yangyi
Qi, Mengdie
Lu, Guohua
HequanLi
author_sort Yang, Yanfei
collection PubMed
description Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of a 50-year-old patient who was diagnosed with ABPA presenting with high level of CEA and eosinophils. Besides,we used immunohistochemistry and immunofluorescence to identify eosinophils and CEA in sections which were obtained by Endobronchial ultrasound-guided transbronchial lung biopsy aspiration (EBUS-TBLB). The sections were then visualized using confocal microscopy. We also retrospectively analyzed a cohort of 37 ABPA patients between January 2013 and December 2019 in our hospital. We found the patient whose serum CEA levels were consistent with eosinophils during the follow-up (r = 0.929, P = 0.022). The positive expression of CEA and abnormal expression of eosinophils was higher in the ABPA tissue compared to the normal lung tissue. The co-localization was represented as pixels containing both red and green color in the image (with various shades of orange and yellow) which signified that eosinophils were immunohistochemically positive for CEA. Patients with higher levels of eosinophils had higher levels of CEA in the serum (P < 0.001). The results of Pearson correlation analysis showed that the levels of eosinophils were positively correlated with serum CEA levels (r = 0.459 and r = 0.506, P = 0.004 and P = 0.001). Serum CEA level is elevated in ABPA patients. The elevated serum CEA level was shown to be normalized after treatment. Increased CEA levels in ABPA patients may be positively correlated with eosinophil levels, and eosinophils may be served as CEA-secreting cells in patients with ABPA.
format Online
Article
Text
id pubmed-7889926
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-78899262021-02-22 Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients Yang, Yanfei Gao, qiqi Jin, Yangyi Qi, Mengdie Lu, Guohua HequanLi Sci Rep Article Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of a 50-year-old patient who was diagnosed with ABPA presenting with high level of CEA and eosinophils. Besides,we used immunohistochemistry and immunofluorescence to identify eosinophils and CEA in sections which were obtained by Endobronchial ultrasound-guided transbronchial lung biopsy aspiration (EBUS-TBLB). The sections were then visualized using confocal microscopy. We also retrospectively analyzed a cohort of 37 ABPA patients between January 2013 and December 2019 in our hospital. We found the patient whose serum CEA levels were consistent with eosinophils during the follow-up (r = 0.929, P = 0.022). The positive expression of CEA and abnormal expression of eosinophils was higher in the ABPA tissue compared to the normal lung tissue. The co-localization was represented as pixels containing both red and green color in the image (with various shades of orange and yellow) which signified that eosinophils were immunohistochemically positive for CEA. Patients with higher levels of eosinophils had higher levels of CEA in the serum (P < 0.001). The results of Pearson correlation analysis showed that the levels of eosinophils were positively correlated with serum CEA levels (r = 0.459 and r = 0.506, P = 0.004 and P = 0.001). Serum CEA level is elevated in ABPA patients. The elevated serum CEA level was shown to be normalized after treatment. Increased CEA levels in ABPA patients may be positively correlated with eosinophil levels, and eosinophils may be served as CEA-secreting cells in patients with ABPA. Nature Publishing Group UK 2021-02-17 /pmc/articles/PMC7889926/ /pubmed/33597608 http://dx.doi.org/10.1038/s41598-021-83470-z Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Yang, Yanfei
Gao, qiqi
Jin, Yangyi
Qi, Mengdie
Lu, Guohua
HequanLi
Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_full Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_fullStr Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_full_unstemmed Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_short Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_sort eosinophils may serve as cea-secreting cells for allergic bronchopulmonary aspergillosis (abpa) patients
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7889926/
https://www.ncbi.nlm.nih.gov/pubmed/33597608
http://dx.doi.org/10.1038/s41598-021-83470-z
work_keys_str_mv AT yangyanfei eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
AT gaoqiqi eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
AT jinyangyi eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
AT qimengdie eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
AT luguohua eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
AT hequanli eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients