Cargando…

Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review

BACKGROUND: Despite a substantial increase in the adoption of electronic medical records (EMRs) in primary health care settings, the use of advanced EMR features is limited. Several studies have identified both barriers and facilitating factors that influence primary care physicians’ (PCPs) use of a...

Descripción completa

Detalles Bibliográficos
Autores principales: Rahal, Rana Melissa, Mercer, Jay, Kuziemsky, Craig, Yaya, Sanni
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7893965/
https://www.ncbi.nlm.nih.gov/pubmed/33607986
http://dx.doi.org/10.1186/s12911-021-01434-9
_version_ 1783653153654177792
author Rahal, Rana Melissa
Mercer, Jay
Kuziemsky, Craig
Yaya, Sanni
author_facet Rahal, Rana Melissa
Mercer, Jay
Kuziemsky, Craig
Yaya, Sanni
author_sort Rahal, Rana Melissa
collection PubMed
description BACKGROUND: Despite a substantial increase in the adoption of electronic medical records (EMRs) in primary health care settings, the use of advanced EMR features is limited. Several studies have identified both barriers and facilitating factors that influence primary care physicians’ (PCPs) use of advanced EMR features and the maturation of their EMR use. The purpose of this study is to explore and identify the factors that impact PCPs’ mature use of EMRs. METHODS: A systematic review was conducted in accordance with the Cochrane Handbook. The MEDLINE, Embase, and PsycINFO electronic databases were searched from 1946 to June 13, 2019. Two independent reviewers screened the studies for eligibility; to be included, studies had to address factors influencing PCPs’ mature use of EMRs. A narrative synthesis was conducted to collate study findings and to report on patterns identified across studies. The quality of the studies was also appraised. RESULTS: Of the 1893 studies identified, 14 were included in this study. Reported factors that influenced PCPs’ mature use of EMRs fell into one of the following 5 categories: technology, people, organization, resources, and policy. Concerns about the EMR system’s functionality, lack of physician awareness of EMR functionality, limited physician availability to learn more about EMRs, the habitual use of successfully completing clinical tasks using only basic EMR features, business-oriented organizational objectives, lack of vendor training, limited resource availability, and lack of physician readiness were reported as barriers to PCPs’ mature use of EMRs. The motivation of physicians, user satisfaction, coaching and peer mentoring, EMR experience, gender, physician perception, transition planning for changes in roles and work processes, team-based care, adequate technical support and training, sharing resources, practices affiliated with an integrated delivery system, financial incentives, and policies to increase EMR use all had a favorable impact on PCPs’ use of advanced EMR features. CONCLUSIONS: By using a narrative synthesis to synthesize the evidence, we identified interrelated factors influencing the mature use of EMRs by PCPs. The findings underline the need to provide adequate training and policies that facilitate the mature use of EMRs by PCPs. Trial registration: PROSPERO CRD42019137526.
format Online
Article
Text
id pubmed-7893965
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-78939652021-02-22 Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review Rahal, Rana Melissa Mercer, Jay Kuziemsky, Craig Yaya, Sanni BMC Med Inform Decis Mak Research Article BACKGROUND: Despite a substantial increase in the adoption of electronic medical records (EMRs) in primary health care settings, the use of advanced EMR features is limited. Several studies have identified both barriers and facilitating factors that influence primary care physicians’ (PCPs) use of advanced EMR features and the maturation of their EMR use. The purpose of this study is to explore and identify the factors that impact PCPs’ mature use of EMRs. METHODS: A systematic review was conducted in accordance with the Cochrane Handbook. The MEDLINE, Embase, and PsycINFO electronic databases were searched from 1946 to June 13, 2019. Two independent reviewers screened the studies for eligibility; to be included, studies had to address factors influencing PCPs’ mature use of EMRs. A narrative synthesis was conducted to collate study findings and to report on patterns identified across studies. The quality of the studies was also appraised. RESULTS: Of the 1893 studies identified, 14 were included in this study. Reported factors that influenced PCPs’ mature use of EMRs fell into one of the following 5 categories: technology, people, organization, resources, and policy. Concerns about the EMR system’s functionality, lack of physician awareness of EMR functionality, limited physician availability to learn more about EMRs, the habitual use of successfully completing clinical tasks using only basic EMR features, business-oriented organizational objectives, lack of vendor training, limited resource availability, and lack of physician readiness were reported as barriers to PCPs’ mature use of EMRs. The motivation of physicians, user satisfaction, coaching and peer mentoring, EMR experience, gender, physician perception, transition planning for changes in roles and work processes, team-based care, adequate technical support and training, sharing resources, practices affiliated with an integrated delivery system, financial incentives, and policies to increase EMR use all had a favorable impact on PCPs’ use of advanced EMR features. CONCLUSIONS: By using a narrative synthesis to synthesize the evidence, we identified interrelated factors influencing the mature use of EMRs by PCPs. The findings underline the need to provide adequate training and policies that facilitate the mature use of EMRs by PCPs. Trial registration: PROSPERO CRD42019137526. BioMed Central 2021-02-19 /pmc/articles/PMC7893965/ /pubmed/33607986 http://dx.doi.org/10.1186/s12911-021-01434-9 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Rahal, Rana Melissa
Mercer, Jay
Kuziemsky, Craig
Yaya, Sanni
Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title_full Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title_fullStr Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title_full_unstemmed Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title_short Factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
title_sort factors affecting the mature use of electronic medical records by primary care physicians: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7893965/
https://www.ncbi.nlm.nih.gov/pubmed/33607986
http://dx.doi.org/10.1186/s12911-021-01434-9
work_keys_str_mv AT rahalranamelissa factorsaffectingthematureuseofelectronicmedicalrecordsbyprimarycarephysiciansasystematicreview
AT mercerjay factorsaffectingthematureuseofelectronicmedicalrecordsbyprimarycarephysiciansasystematicreview
AT kuziemskycraig factorsaffectingthematureuseofelectronicmedicalrecordsbyprimarycarephysiciansasystematicreview
AT yayasanni factorsaffectingthematureuseofelectronicmedicalrecordsbyprimarycarephysiciansasystematicreview