Cargando…

Isoluminant stimuli in a familiar discrete keying sequence task can be ignored

Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli....

Descripción completa

Detalles Bibliográficos
Autor principal: Verwey, Willem B.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Berlin Heidelberg 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7900095/
https://www.ncbi.nlm.nih.gov/pubmed/31811366
http://dx.doi.org/10.1007/s00426-019-01277-0
_version_ 1783654149774114816
author Verwey, Willem B.
author_facet Verwey, Willem B.
author_sort Verwey, Willem B.
collection PubMed
description Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli. Two experiments were performed in which participants practiced two 7-keypress sequences by responding to isoluminant key-specific stimuli. In the mixed condition of the ensuing test phase, the stimuli were displayed only occasionally, and the question was whether this would make participants stop processing these stimuli. In Experiment 1, the benefit of displaying stimuli was assessed after substantial practice, while Experiment 2 examined development of this benefit across practice. The results of Experiment 1 showed that participants rely a little less on these stimuli when they are displayed only occasionally, but Experiment 2 revealed that participants quickly developed high awareness, and that they ignored these stimuli already after limited practice. These findings confirm that participants can choose to ignore these isoluminant stimuli but tend to use them when they are displayed. These and other findings show in some detail how various cognitive systems interact to produce familiar keying sequences.
format Online
Article
Text
id pubmed-7900095
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Springer Berlin Heidelberg
record_format MEDLINE/PubMed
spelling pubmed-79000952021-03-05 Isoluminant stimuli in a familiar discrete keying sequence task can be ignored Verwey, Willem B. Psychol Res Original Article Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli. Two experiments were performed in which participants practiced two 7-keypress sequences by responding to isoluminant key-specific stimuli. In the mixed condition of the ensuing test phase, the stimuli were displayed only occasionally, and the question was whether this would make participants stop processing these stimuli. In Experiment 1, the benefit of displaying stimuli was assessed after substantial practice, while Experiment 2 examined development of this benefit across practice. The results of Experiment 1 showed that participants rely a little less on these stimuli when they are displayed only occasionally, but Experiment 2 revealed that participants quickly developed high awareness, and that they ignored these stimuli already after limited practice. These findings confirm that participants can choose to ignore these isoluminant stimuli but tend to use them when they are displayed. These and other findings show in some detail how various cognitive systems interact to produce familiar keying sequences. Springer Berlin Heidelberg 2019-12-06 2021 /pmc/articles/PMC7900095/ /pubmed/31811366 http://dx.doi.org/10.1007/s00426-019-01277-0 Text en © The Author(s) 2019 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Original Article
Verwey, Willem B.
Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title_full Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title_fullStr Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title_full_unstemmed Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title_short Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
title_sort isoluminant stimuli in a familiar discrete keying sequence task can be ignored
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7900095/
https://www.ncbi.nlm.nih.gov/pubmed/31811366
http://dx.doi.org/10.1007/s00426-019-01277-0
work_keys_str_mv AT verweywillemb isoluminantstimuliinafamiliardiscretekeyingsequencetaskcanbeignored