Cargando…
Isoluminant stimuli in a familiar discrete keying sequence task can be ignored
Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli....
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7900095/ https://www.ncbi.nlm.nih.gov/pubmed/31811366 http://dx.doi.org/10.1007/s00426-019-01277-0 |
_version_ | 1783654149774114816 |
---|---|
author | Verwey, Willem B. |
author_facet | Verwey, Willem B. |
author_sort | Verwey, Willem B. |
collection | PubMed |
description | Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli. Two experiments were performed in which participants practiced two 7-keypress sequences by responding to isoluminant key-specific stimuli. In the mixed condition of the ensuing test phase, the stimuli were displayed only occasionally, and the question was whether this would make participants stop processing these stimuli. In Experiment 1, the benefit of displaying stimuli was assessed after substantial practice, while Experiment 2 examined development of this benefit across practice. The results of Experiment 1 showed that participants rely a little less on these stimuli when they are displayed only occasionally, but Experiment 2 revealed that participants quickly developed high awareness, and that they ignored these stimuli already after limited practice. These findings confirm that participants can choose to ignore these isoluminant stimuli but tend to use them when they are displayed. These and other findings show in some detail how various cognitive systems interact to produce familiar keying sequences. |
format | Online Article Text |
id | pubmed-7900095 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-79000952021-03-05 Isoluminant stimuli in a familiar discrete keying sequence task can be ignored Verwey, Willem B. Psychol Res Original Article Motor sequencing models suggest that when with extensive practice sequence representations have developed, stimuli indicating the individual sequence elements may no longer be used for sequence execution. However, it is not clear whether participants can at all refrain from processing these stimuli. Two experiments were performed in which participants practiced two 7-keypress sequences by responding to isoluminant key-specific stimuli. In the mixed condition of the ensuing test phase, the stimuli were displayed only occasionally, and the question was whether this would make participants stop processing these stimuli. In Experiment 1, the benefit of displaying stimuli was assessed after substantial practice, while Experiment 2 examined development of this benefit across practice. The results of Experiment 1 showed that participants rely a little less on these stimuli when they are displayed only occasionally, but Experiment 2 revealed that participants quickly developed high awareness, and that they ignored these stimuli already after limited practice. These findings confirm that participants can choose to ignore these isoluminant stimuli but tend to use them when they are displayed. These and other findings show in some detail how various cognitive systems interact to produce familiar keying sequences. Springer Berlin Heidelberg 2019-12-06 2021 /pmc/articles/PMC7900095/ /pubmed/31811366 http://dx.doi.org/10.1007/s00426-019-01277-0 Text en © The Author(s) 2019 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Original Article Verwey, Willem B. Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title | Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title_full | Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title_fullStr | Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title_full_unstemmed | Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title_short | Isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
title_sort | isoluminant stimuli in a familiar discrete keying sequence task can be ignored |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7900095/ https://www.ncbi.nlm.nih.gov/pubmed/31811366 http://dx.doi.org/10.1007/s00426-019-01277-0 |
work_keys_str_mv | AT verweywillemb isoluminantstimuliinafamiliardiscretekeyingsequencetaskcanbeignored |