Cargando…
Role of endothelial microRNA 155 on capillary leakage in systemic inflammation
BACKGROUND: Capillary leakage is a key contributor to the pathological host response to infections. The underlying mechanisms remain incompletely understood, and the role of microRNAs (MIR) has not been investigated in detail. We hypothesized that specific MIRs might be regulated directly in the end...
Autores principales: | , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7901081/ https://www.ncbi.nlm.nih.gov/pubmed/33618730 http://dx.doi.org/10.1186/s13054-021-03500-0 |
_version_ | 1783654331345534976 |
---|---|
author | Etzrodt, Valerie Idowu, Temitayo O. Schenk, Heiko Seeliger, Benjamin Prasse, Antje Thamm, Kristina Pape, Thorben Müller-Deile, Janina van Meurs, Matijs Thum, Thomas Garg, Ankita Geffers, Robert Stahl, Klaus Parikh, Samir M. Haller, Hermann David, Sascha |
author_facet | Etzrodt, Valerie Idowu, Temitayo O. Schenk, Heiko Seeliger, Benjamin Prasse, Antje Thamm, Kristina Pape, Thorben Müller-Deile, Janina van Meurs, Matijs Thum, Thomas Garg, Ankita Geffers, Robert Stahl, Klaus Parikh, Samir M. Haller, Hermann David, Sascha |
author_sort | Etzrodt, Valerie |
collection | PubMed |
description | BACKGROUND: Capillary leakage is a key contributor to the pathological host response to infections. The underlying mechanisms remain incompletely understood, and the role of microRNAs (MIR) has not been investigated in detail. We hypothesized that specific MIRs might be regulated directly in the endothelium thereby contributing to vascular leakage. METHODS: SmallRNA sequencing of endotoxemic murine pulmonary endothelial cells (ECs) was done to detect regulated vascular MIRs. In vivo models: transgenic zebrafish (flk1:mCherry/l-fabp:eGFP-DPB), knockout/wildtype mouse (B6.Cg-Mir155tm1.1Rsky/J); disease models: LPS 17.5 mg/kgBW and cecal ligation and puncture (CLP); in vitro models: stimulated human umbilical vein EC (HUVECs), transendothelial electrical resistance. RESULTS: Endothelial MIR155 was identified as a promising candidate in endotoxemic murine pulmonary ECs (25 × upregulation). Experimental overexpression in a transgenic zebrafish line and in HUVECs was sufficient to induce spontaneous vascular leakage. To the contrary, genetic MIR155 reduction protects against permeability both in vitro and in endotoxemia in vivo in MIR155 heterozygote knockout mice thereby improving survival by 40%. A tight junction protein, Claudin-1, was down-regulated both in endotoxemia and by experimental MIR155 overexpression. Translationally, MIR155 was detectable at high levels in bronchoalveolar fluid of patients with ARDS compared to healthy human subjects. CONCLUSIONS: We found that MIR155 is upregulated in the endothelium in mouse and men as part of a systemic inflammatory response and might contribute to the pathophysiology of vascular leakage in a Claudin-1-dependent manner. Future studies have to clarify whether MIR155 could be a potential therapeutic target. [Image: see text] |
format | Online Article Text |
id | pubmed-7901081 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-79010812021-02-23 Role of endothelial microRNA 155 on capillary leakage in systemic inflammation Etzrodt, Valerie Idowu, Temitayo O. Schenk, Heiko Seeliger, Benjamin Prasse, Antje Thamm, Kristina Pape, Thorben Müller-Deile, Janina van Meurs, Matijs Thum, Thomas Garg, Ankita Geffers, Robert Stahl, Klaus Parikh, Samir M. Haller, Hermann David, Sascha Crit Care Research BACKGROUND: Capillary leakage is a key contributor to the pathological host response to infections. The underlying mechanisms remain incompletely understood, and the role of microRNAs (MIR) has not been investigated in detail. We hypothesized that specific MIRs might be regulated directly in the endothelium thereby contributing to vascular leakage. METHODS: SmallRNA sequencing of endotoxemic murine pulmonary endothelial cells (ECs) was done to detect regulated vascular MIRs. In vivo models: transgenic zebrafish (flk1:mCherry/l-fabp:eGFP-DPB), knockout/wildtype mouse (B6.Cg-Mir155tm1.1Rsky/J); disease models: LPS 17.5 mg/kgBW and cecal ligation and puncture (CLP); in vitro models: stimulated human umbilical vein EC (HUVECs), transendothelial electrical resistance. RESULTS: Endothelial MIR155 was identified as a promising candidate in endotoxemic murine pulmonary ECs (25 × upregulation). Experimental overexpression in a transgenic zebrafish line and in HUVECs was sufficient to induce spontaneous vascular leakage. To the contrary, genetic MIR155 reduction protects against permeability both in vitro and in endotoxemia in vivo in MIR155 heterozygote knockout mice thereby improving survival by 40%. A tight junction protein, Claudin-1, was down-regulated both in endotoxemia and by experimental MIR155 overexpression. Translationally, MIR155 was detectable at high levels in bronchoalveolar fluid of patients with ARDS compared to healthy human subjects. CONCLUSIONS: We found that MIR155 is upregulated in the endothelium in mouse and men as part of a systemic inflammatory response and might contribute to the pathophysiology of vascular leakage in a Claudin-1-dependent manner. Future studies have to clarify whether MIR155 could be a potential therapeutic target. [Image: see text] BioMed Central 2021-02-22 /pmc/articles/PMC7901081/ /pubmed/33618730 http://dx.doi.org/10.1186/s13054-021-03500-0 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Etzrodt, Valerie Idowu, Temitayo O. Schenk, Heiko Seeliger, Benjamin Prasse, Antje Thamm, Kristina Pape, Thorben Müller-Deile, Janina van Meurs, Matijs Thum, Thomas Garg, Ankita Geffers, Robert Stahl, Klaus Parikh, Samir M. Haller, Hermann David, Sascha Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title | Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title_full | Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title_fullStr | Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title_full_unstemmed | Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title_short | Role of endothelial microRNA 155 on capillary leakage in systemic inflammation |
title_sort | role of endothelial microrna 155 on capillary leakage in systemic inflammation |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7901081/ https://www.ncbi.nlm.nih.gov/pubmed/33618730 http://dx.doi.org/10.1186/s13054-021-03500-0 |
work_keys_str_mv | AT etzrodtvalerie roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT idowutemitayoo roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT schenkheiko roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT seeligerbenjamin roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT prasseantje roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT thammkristina roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT papethorben roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT mullerdeilejanina roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT vanmeursmatijs roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT thumthomas roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT gargankita roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT geffersrobert roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT stahlklaus roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT parikhsamirm roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT hallerhermann roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation AT davidsascha roleofendothelialmicrorna155oncapillaryleakageinsystemicinflammation |