Cargando…

Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters

BACKGROUND: As obesity is increasing worldwide, obese people use various methods to get rid of excess weight. BMS309403 (A drug) is a specific inhibitor of fatty acid binding protein 4. In this study, the effects of the BMS309403 on serum biochemical markers, testis tissue spermatogenesis and apopto...

Descripción completa

Detalles Bibliográficos
Autores principales: Balci, Tevfik, Kocabas, Rahim, Cuce, Gokhan, Akoz, Mehmet
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Avicenna Research Institute 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7903665/
https://www.ncbi.nlm.nih.gov/pubmed/33680881
http://dx.doi.org/10.18502/jri.v22i1.4991
_version_ 1783654780444344320
author Balci, Tevfik
Kocabas, Rahim
Cuce, Gokhan
Akoz, Mehmet
author_facet Balci, Tevfik
Kocabas, Rahim
Cuce, Gokhan
Akoz, Mehmet
author_sort Balci, Tevfik
collection PubMed
description BACKGROUND: As obesity is increasing worldwide, obese people use various methods to get rid of excess weight. BMS309403 (A drug) is a specific inhibitor of fatty acid binding protein 4. In this study, the effects of the BMS309403 on serum biochemical markers, testis tissue spermatogenesis and apoptotic markers were investigated in male mice. METHODS: Balb/c mice (total=56, each group n=14) were divided into control, obese control, obese solvent and obese drug groups. The obese control, obese solvent and obese drug groups were fed on the high sucrose diet to lead to obesity. After the development of obesity, BMS309403 was orally administered to the obese drug group for six weeks. It was performed in testicular tissues (Johnson Score and apoptosis markers) and biochemical tests (total testosterone, sex hormone binding globulin, inhibin-B tests and free androgen index) were used to evaluate reproductive parameters. The p<0.05 was considered to indicate a statistical significance. RESULTS: Serum fatty acid binding protein 4 levels were higher in obese control group and obese solvent group, compared to control (p<0.05) and obese drug groups (p<0.001). Serum total testosterone, free androgen index, inhibin-B, sex hormone binding globulin levels, testicular tissue B-cell lymphoma-2 expression level and Johnson Score parameters were lower in all obese groups compared with the control group. Inhibin-B levels and Johnson Score results were lower in obese drug group compared to other two obese groups (p<0.05). CONCLUSION: Contrary to expectations, the use of BMS309403 negatively affected male reproductive parameters. Negative changes in reproductive parameters may be a result of the increased lee index of obesity.
format Online
Article
Text
id pubmed-7903665
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Avicenna Research Institute
record_format MEDLINE/PubMed
spelling pubmed-79036652021-03-04 Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters Balci, Tevfik Kocabas, Rahim Cuce, Gokhan Akoz, Mehmet J Reprod Infertil Original Article BACKGROUND: As obesity is increasing worldwide, obese people use various methods to get rid of excess weight. BMS309403 (A drug) is a specific inhibitor of fatty acid binding protein 4. In this study, the effects of the BMS309403 on serum biochemical markers, testis tissue spermatogenesis and apoptotic markers were investigated in male mice. METHODS: Balb/c mice (total=56, each group n=14) were divided into control, obese control, obese solvent and obese drug groups. The obese control, obese solvent and obese drug groups were fed on the high sucrose diet to lead to obesity. After the development of obesity, BMS309403 was orally administered to the obese drug group for six weeks. It was performed in testicular tissues (Johnson Score and apoptosis markers) and biochemical tests (total testosterone, sex hormone binding globulin, inhibin-B tests and free androgen index) were used to evaluate reproductive parameters. The p<0.05 was considered to indicate a statistical significance. RESULTS: Serum fatty acid binding protein 4 levels were higher in obese control group and obese solvent group, compared to control (p<0.05) and obese drug groups (p<0.001). Serum total testosterone, free androgen index, inhibin-B, sex hormone binding globulin levels, testicular tissue B-cell lymphoma-2 expression level and Johnson Score parameters were lower in all obese groups compared with the control group. Inhibin-B levels and Johnson Score results were lower in obese drug group compared to other two obese groups (p<0.05). CONCLUSION: Contrary to expectations, the use of BMS309403 negatively affected male reproductive parameters. Negative changes in reproductive parameters may be a result of the increased lee index of obesity. Avicenna Research Institute 2021 /pmc/articles/PMC7903665/ /pubmed/33680881 http://dx.doi.org/10.18502/jri.v22i1.4991 Text en Copyright© 2021, Avicenna Research Institute. This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, appropriate credit is given, any changes made indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/
spellingShingle Original Article
Balci, Tevfik
Kocabas, Rahim
Cuce, Gokhan
Akoz, Mehmet
Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title_full Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title_fullStr Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title_full_unstemmed Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title_short Inhibition of Fatty Acid Binding Protein 4 in Obese Male Mice Adversely Affects Reproductive Parameters
title_sort inhibition of fatty acid binding protein 4 in obese male mice adversely affects reproductive parameters
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7903665/
https://www.ncbi.nlm.nih.gov/pubmed/33680881
http://dx.doi.org/10.18502/jri.v22i1.4991
work_keys_str_mv AT balcitevfik inhibitionoffattyacidbindingprotein4inobesemalemiceadverselyaffectsreproductiveparameters
AT kocabasrahim inhibitionoffattyacidbindingprotein4inobesemalemiceadverselyaffectsreproductiveparameters
AT cucegokhan inhibitionoffattyacidbindingprotein4inobesemalemiceadverselyaffectsreproductiveparameters
AT akozmehmet inhibitionoffattyacidbindingprotein4inobesemalemiceadverselyaffectsreproductiveparameters