Cargando…
Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China
Anaplasma spp. are important zoonotic tick-borne pathogens that impact on human health. There are few reports on the prevalence and molecular genetic characteristics of Cervidae species in China. The purpose of this study, therefore, was to investigate the presence of Anaplasma spp. in blood samples...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7905395/ https://www.ncbi.nlm.nih.gov/pubmed/33665083 http://dx.doi.org/10.1016/j.ijppaw.2021.02.008 |
_version_ | 1783655105314160640 |
---|---|
author | Li, Tao Cui, Yanyan Xiao, Jinxiu Jiang, Yuxi Ning, Changshen Qi, Meng Tao, Dayong |
author_facet | Li, Tao Cui, Yanyan Xiao, Jinxiu Jiang, Yuxi Ning, Changshen Qi, Meng Tao, Dayong |
author_sort | Li, Tao |
collection | PubMed |
description | Anaplasma spp. are important zoonotic tick-borne pathogens that impact on human health. There are few reports on the prevalence and molecular genetic characteristics of Cervidae species in China. The purpose of this study, therefore, was to investigate the presence of Anaplasma spp. in blood samples of Tian Shan wapiti (Cervus elaphus songaricus) in the Xinjiang Uygur Autonomous Region of China, and conduct phylogenetic analyses. A total of 50 blood samples (wild deer n = 26, and captive deer n = 24) were collected from the deer. PCR was used to detect Anaplasma spp. in the blood samples. Forty percent (20) of the samples were found to contain Anaplasma spp. Three Anaplasma species DNA were detected in deer blood samples: A. bovis (n = 13), A. ovis (n = 18), and A. phagocytophilum (n = 11). Among the 20 Anaplasma spp. positive samples, 14 were mixed infection of two or three pathogens. The prevalence of Anaplasma species in wild deer was significantly higher than that of captive deer, 73.1% (19) vs 4.2% (1) respectively, (p < 0.01). Two A. ovis sequence types (AB1, and AB2), three A. ovis sequence types (AO1-AO3), and one A. phagocytophilum sequence type (AP1) were obtained in this study. The sequences of AO1 shared 100% identity with a human isolate from Cyprus. Our results suggest that wild deer are more likely to become infected with Anaplasma spp. than captive individuals, and thus, could potentially transmit pathogens to humans. |
format | Online Article Text |
id | pubmed-7905395 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-79053952021-03-03 Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China Li, Tao Cui, Yanyan Xiao, Jinxiu Jiang, Yuxi Ning, Changshen Qi, Meng Tao, Dayong Int J Parasitol Parasites Wildl Article Anaplasma spp. are important zoonotic tick-borne pathogens that impact on human health. There are few reports on the prevalence and molecular genetic characteristics of Cervidae species in China. The purpose of this study, therefore, was to investigate the presence of Anaplasma spp. in blood samples of Tian Shan wapiti (Cervus elaphus songaricus) in the Xinjiang Uygur Autonomous Region of China, and conduct phylogenetic analyses. A total of 50 blood samples (wild deer n = 26, and captive deer n = 24) were collected from the deer. PCR was used to detect Anaplasma spp. in the blood samples. Forty percent (20) of the samples were found to contain Anaplasma spp. Three Anaplasma species DNA were detected in deer blood samples: A. bovis (n = 13), A. ovis (n = 18), and A. phagocytophilum (n = 11). Among the 20 Anaplasma spp. positive samples, 14 were mixed infection of two or three pathogens. The prevalence of Anaplasma species in wild deer was significantly higher than that of captive deer, 73.1% (19) vs 4.2% (1) respectively, (p < 0.01). Two A. ovis sequence types (AB1, and AB2), three A. ovis sequence types (AO1-AO3), and one A. phagocytophilum sequence type (AP1) were obtained in this study. The sequences of AO1 shared 100% identity with a human isolate from Cyprus. Our results suggest that wild deer are more likely to become infected with Anaplasma spp. than captive individuals, and thus, could potentially transmit pathogens to humans. Elsevier 2021-02-14 /pmc/articles/PMC7905395/ /pubmed/33665083 http://dx.doi.org/10.1016/j.ijppaw.2021.02.008 Text en © 2021 The Authors http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Article Li, Tao Cui, Yanyan Xiao, Jinxiu Jiang, Yuxi Ning, Changshen Qi, Meng Tao, Dayong Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title | Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title_full | Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title_fullStr | Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title_full_unstemmed | Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title_short | Identification of Anaplasma spp. in Tian Shan wapiti deer (Cervus elaphus songaricus) in Xinjiang, China |
title_sort | identification of anaplasma spp. in tian shan wapiti deer (cervus elaphus songaricus) in xinjiang, china |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7905395/ https://www.ncbi.nlm.nih.gov/pubmed/33665083 http://dx.doi.org/10.1016/j.ijppaw.2021.02.008 |
work_keys_str_mv | AT litao identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT cuiyanyan identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT xiaojinxiu identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT jiangyuxi identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT ningchangshen identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT qimeng identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina AT taodayong identificationofanaplasmasppintianshanwapitideercervuselaphussongaricusinxinjiangchina |