Cargando…

Diagnosis of tuberculosis in wildlife: a systematic review

Animal tuberculosis (TB) is a multi-host disease caused by members of the Mycobacterium tuberculosis complex (MTC). Due to its impact on economy, sanitary standards of milk and meat industry, public health and conservation, TB control is an actively ongoing research subject. Several wildlife species...

Descripción completa

Detalles Bibliográficos
Autores principales: Thomas, Jobin, Balseiro, Ana, Gortázar, Christian, Risalde, María A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7905575/
https://www.ncbi.nlm.nih.gov/pubmed/33627188
http://dx.doi.org/10.1186/s13567-020-00881-y
_version_ 1783655133690724352
author Thomas, Jobin
Balseiro, Ana
Gortázar, Christian
Risalde, María A.
author_facet Thomas, Jobin
Balseiro, Ana
Gortázar, Christian
Risalde, María A.
author_sort Thomas, Jobin
collection PubMed
description Animal tuberculosis (TB) is a multi-host disease caused by members of the Mycobacterium tuberculosis complex (MTC). Due to its impact on economy, sanitary standards of milk and meat industry, public health and conservation, TB control is an actively ongoing research subject. Several wildlife species are involved in the maintenance and transmission of TB, so that new approaches to wildlife TB diagnosis have gained relevance in recent years. Diagnosis is a paramount step for screening, epidemiological investigation, as well as for ensuring the success of control strategies such as vaccination trials. This is the first review that systematically addresses data available for the diagnosis of TB in wildlife following the Preferred Reporting Items of Systematic Reviews and Meta-Analyses (PRISMA) guidelines. The article also gives an overview of the factors related to host, environment, sampling, and diagnostic techniques which can affect test performance. After three screenings, 124 articles were considered for systematic review. Literature indicates that post-mortem examination and culture are useful methods for disease surveillance, but immunological diagnostic tests based on cellular and humoral immune response detection are gaining importance in wildlife TB diagnosis. Among them, serological tests are especially useful in wildlife because they are relatively inexpensive and easy to perform, facilitate large-scale surveillance and can be used both ante- and post-mortem. Currently available studies assessed test performance mostly in cervids, European badgers, wild suids and wild bovids. Research to improve diagnostic tests for wildlife TB diagnosis is still needed in order to reach accurate, rapid and cost-effective diagnostic techniques adequate to a broad range of target species and consistent over space and time to allow proper disease monitoring.
format Online
Article
Text
id pubmed-7905575
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-79055752021-02-25 Diagnosis of tuberculosis in wildlife: a systematic review Thomas, Jobin Balseiro, Ana Gortázar, Christian Risalde, María A. Vet Res Review Animal tuberculosis (TB) is a multi-host disease caused by members of the Mycobacterium tuberculosis complex (MTC). Due to its impact on economy, sanitary standards of milk and meat industry, public health and conservation, TB control is an actively ongoing research subject. Several wildlife species are involved in the maintenance and transmission of TB, so that new approaches to wildlife TB diagnosis have gained relevance in recent years. Diagnosis is a paramount step for screening, epidemiological investigation, as well as for ensuring the success of control strategies such as vaccination trials. This is the first review that systematically addresses data available for the diagnosis of TB in wildlife following the Preferred Reporting Items of Systematic Reviews and Meta-Analyses (PRISMA) guidelines. The article also gives an overview of the factors related to host, environment, sampling, and diagnostic techniques which can affect test performance. After three screenings, 124 articles were considered for systematic review. Literature indicates that post-mortem examination and culture are useful methods for disease surveillance, but immunological diagnostic tests based on cellular and humoral immune response detection are gaining importance in wildlife TB diagnosis. Among them, serological tests are especially useful in wildlife because they are relatively inexpensive and easy to perform, facilitate large-scale surveillance and can be used both ante- and post-mortem. Currently available studies assessed test performance mostly in cervids, European badgers, wild suids and wild bovids. Research to improve diagnostic tests for wildlife TB diagnosis is still needed in order to reach accurate, rapid and cost-effective diagnostic techniques adequate to a broad range of target species and consistent over space and time to allow proper disease monitoring. BioMed Central 2021-02-24 2021 /pmc/articles/PMC7905575/ /pubmed/33627188 http://dx.doi.org/10.1186/s13567-020-00881-y Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Thomas, Jobin
Balseiro, Ana
Gortázar, Christian
Risalde, María A.
Diagnosis of tuberculosis in wildlife: a systematic review
title Diagnosis of tuberculosis in wildlife: a systematic review
title_full Diagnosis of tuberculosis in wildlife: a systematic review
title_fullStr Diagnosis of tuberculosis in wildlife: a systematic review
title_full_unstemmed Diagnosis of tuberculosis in wildlife: a systematic review
title_short Diagnosis of tuberculosis in wildlife: a systematic review
title_sort diagnosis of tuberculosis in wildlife: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7905575/
https://www.ncbi.nlm.nih.gov/pubmed/33627188
http://dx.doi.org/10.1186/s13567-020-00881-y
work_keys_str_mv AT thomasjobin diagnosisoftuberculosisinwildlifeasystematicreview
AT balseiroana diagnosisoftuberculosisinwildlifeasystematicreview
AT gortazarchristian diagnosisoftuberculosisinwildlifeasystematicreview
AT risaldemariaa diagnosisoftuberculosisinwildlifeasystematicreview