An Update on Self-Amplifying mRNA Vaccine Development

This review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported...

Descripción completa

Detalles Bibliográficos
Autores principales: Blakney, Anna K., Ip, Shell, Geall, Andrew J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Review
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7911542/
https://www.ncbi.nlm.nih.gov/pubmed/33525396
http://dx.doi.org/10.3390/vaccines9020097
_version_ 1783656366290763776
author Blakney, Anna K.
Ip, Shell
Geall, Andrew J.
author_facet Blakney, Anna K.
Ip, Shell
Geall, Andrew J.
author_sort Blakney, Anna K.
collection PubMed
description This review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported in the last five years and will discuss future prospects.
format Online
Article
Text
id pubmed-7911542
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-79115422021-02-28 An Update on Self-Amplifying mRNA Vaccine Development Blakney, Anna K. Ip, Shell Geall, Andrew J. Vaccines (Basel) Review This review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported in the last five years and will discuss future prospects. MDPI 2021-01-28 /pmc/articles/PMC7911542/ /pubmed/33525396 http://dx.doi.org/10.3390/vaccines9020097 Text en © 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Blakney, Anna K.
Ip, Shell
Geall, Andrew J.
An Update on Self-Amplifying mRNA Vaccine Development
title An Update on Self-Amplifying mRNA Vaccine Development
title_full An Update on Self-Amplifying mRNA Vaccine Development
title_fullStr An Update on Self-Amplifying mRNA Vaccine Development
title_full_unstemmed An Update on Self-Amplifying mRNA Vaccine Development
title_short An Update on Self-Amplifying mRNA Vaccine Development
title_sort update on self-amplifying mrna vaccine development
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7911542/
https://www.ncbi.nlm.nih.gov/pubmed/33525396
http://dx.doi.org/10.3390/vaccines9020097
work_keys_str_mv AT blakneyannak anupdateonselfamplifyingmrnavaccinedevelopment
AT ipshell anupdateonselfamplifyingmrnavaccinedevelopment
AT geallandrewj anupdateonselfamplifyingmrnavaccinedevelopment
AT blakneyannak updateonselfamplifyingmrnavaccinedevelopment
AT ipshell updateonselfamplifyingmrnavaccinedevelopment
AT geallandrewj updateonselfamplifyingmrnavaccinedevelopment

Ejemplares similares