Cargando…
Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease
Behcet’s disease (BD) is a chronic inflammatory disease with multisystemic involvement. Its etiology is considered to involve complex environmental and genetic factors. Several susceptibility genes for BD, such as human leukocyte antigen (HLA)-A26, IL23R-IL12RB2, IL10 and ERAP1, in addition to the w...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7911745/ https://www.ncbi.nlm.nih.gov/pubmed/33499153 http://dx.doi.org/10.3390/children8020075 |
_version_ | 1783656414137286656 |
---|---|
author | Shiraki, Mayuka Kadowaki, Saori Kadowaki, Tomonori Kawamoto, Norio Ohnishi, Hidenori |
author_facet | Shiraki, Mayuka Kadowaki, Saori Kadowaki, Tomonori Kawamoto, Norio Ohnishi, Hidenori |
author_sort | Shiraki, Mayuka |
collection | PubMed |
description | Behcet’s disease (BD) is a chronic inflammatory disease with multisystemic involvement. Its etiology is considered to involve complex environmental and genetic factors. Several susceptibility genes for BD, such as human leukocyte antigen (HLA)-A26, IL23R-IL12RB2, IL10 and ERAP1, in addition to the well-studied HLA-B51, were mainly identified by genome-wide association studies. A heterozygous mutation in TNFAIP3, which leads to A20 haploinsufficiency, was found to cause an early-onset autoinflammatory disease resembling BD in 2016. Several monogenic diseases associated with primary immunodeficiency disease and trisomy 8 have recently been reported to display BD-like phenotypes. Among the genes causing these diseases, TNFAIP3, NEMO, RELA, NFKB1 and TNFRSF1A are involved in the NF-κB (nuclear factor κ light-chain enhancer of activated B cells) signaling pathway, indicating that this pathway plays an important role in the pathogenesis of BD. Because appropriate treatment may vary depending on the disease, analyzing the genetic background of patients with such diseases is expected to help elucidate the etiology of pediatric BD and assist with its treatment. Here, we summarize recently emerging knowledge about genetic predisposition to BD. |
format | Online Article Text |
id | pubmed-7911745 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-79117452021-02-28 Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease Shiraki, Mayuka Kadowaki, Saori Kadowaki, Tomonori Kawamoto, Norio Ohnishi, Hidenori Children (Basel) Review Behcet’s disease (BD) is a chronic inflammatory disease with multisystemic involvement. Its etiology is considered to involve complex environmental and genetic factors. Several susceptibility genes for BD, such as human leukocyte antigen (HLA)-A26, IL23R-IL12RB2, IL10 and ERAP1, in addition to the well-studied HLA-B51, were mainly identified by genome-wide association studies. A heterozygous mutation in TNFAIP3, which leads to A20 haploinsufficiency, was found to cause an early-onset autoinflammatory disease resembling BD in 2016. Several monogenic diseases associated with primary immunodeficiency disease and trisomy 8 have recently been reported to display BD-like phenotypes. Among the genes causing these diseases, TNFAIP3, NEMO, RELA, NFKB1 and TNFRSF1A are involved in the NF-κB (nuclear factor κ light-chain enhancer of activated B cells) signaling pathway, indicating that this pathway plays an important role in the pathogenesis of BD. Because appropriate treatment may vary depending on the disease, analyzing the genetic background of patients with such diseases is expected to help elucidate the etiology of pediatric BD and assist with its treatment. Here, we summarize recently emerging knowledge about genetic predisposition to BD. MDPI 2021-01-22 /pmc/articles/PMC7911745/ /pubmed/33499153 http://dx.doi.org/10.3390/children8020075 Text en © 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Shiraki, Mayuka Kadowaki, Saori Kadowaki, Tomonori Kawamoto, Norio Ohnishi, Hidenori Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title | Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title_full | Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title_fullStr | Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title_full_unstemmed | Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title_short | Primary Immunodeficiency Disease Mimicking Pediatric Bechet’s Disease |
title_sort | primary immunodeficiency disease mimicking pediatric bechet’s disease |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7911745/ https://www.ncbi.nlm.nih.gov/pubmed/33499153 http://dx.doi.org/10.3390/children8020075 |
work_keys_str_mv | AT shirakimayuka primaryimmunodeficiencydiseasemimickingpediatricbechetsdisease AT kadowakisaori primaryimmunodeficiencydiseasemimickingpediatricbechetsdisease AT kadowakitomonori primaryimmunodeficiencydiseasemimickingpediatricbechetsdisease AT kawamotonorio primaryimmunodeficiencydiseasemimickingpediatricbechetsdisease AT ohnishihidenori primaryimmunodeficiencydiseasemimickingpediatricbechetsdisease |