Cargando…

Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii

Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide bios...

Descripción completa

Detalles Bibliográficos
Autores principales: Huo, Yanbo, Zhang, Bin, Chen, Ling, Zhang, Jing, Zhang, Xing, Zhu, Chuanshu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7926782/
https://www.ncbi.nlm.nih.gov/pubmed/33672407
http://dx.doi.org/10.3390/plants10020418
_version_ 1783659541147156480
author Huo, Yanbo
Zhang, Bin
Chen, Ling
Zhang, Jing
Zhang, Xing
Zhu, Chuanshu
author_facet Huo, Yanbo
Zhang, Bin
Chen, Ling
Zhang, Jing
Zhang, Xing
Zhu, Chuanshu
author_sort Huo, Yanbo
collection PubMed
description Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide biosynthesis remains unclear. In this study, the promoters of TwTPS27a (1496 bp) and TwTPS27b (1862 bp) were isolated and analyzed. Some hormone-/stress-responsive elements and transcription factor (TF) binding sites were predicted in both promoters, which might be responsible for the regulation mechanism of TwTPS27a/b. The β-glucuronidase (GUS) activity analysis in promoter deletion assays under normal and methyl jasmonate (MeJA) conditions showed that the sequence of −921 to −391 bp is the potential core region of the TwTPS27b promoter. And the TGACG-motif, a MeJA-responsive element found in this core region, might be responsible for MeJA-mediated stress induction of GUS activity. Moreover, the TGACG-motif is also known as the TGA TF-binding site. Yeast one-hybrid and GUS transactivation assays confirmed the interaction between the TwTPS27a/b promoters and the TwTGA1 TF (a MeJA-inducible TGA TF upregulating triptolide biosynthesis in T. wilfordii), indicating that TwTPS27a/b are two target genes regulated by TwTGA1. In conclusion, our results provide important information for elucidating the regulatory mechanism of MS genes, TwTPS27a and TwTPS27b, as two target genes of TwTGA1, in jasmonic acid (JA)-inducible triptolide biosynthesis.
format Online
Article
Text
id pubmed-7926782
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-79267822021-03-04 Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii Huo, Yanbo Zhang, Bin Chen, Ling Zhang, Jing Zhang, Xing Zhu, Chuanshu Plants (Basel) Article Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide biosynthesis remains unclear. In this study, the promoters of TwTPS27a (1496 bp) and TwTPS27b (1862 bp) were isolated and analyzed. Some hormone-/stress-responsive elements and transcription factor (TF) binding sites were predicted in both promoters, which might be responsible for the regulation mechanism of TwTPS27a/b. The β-glucuronidase (GUS) activity analysis in promoter deletion assays under normal and methyl jasmonate (MeJA) conditions showed that the sequence of −921 to −391 bp is the potential core region of the TwTPS27b promoter. And the TGACG-motif, a MeJA-responsive element found in this core region, might be responsible for MeJA-mediated stress induction of GUS activity. Moreover, the TGACG-motif is also known as the TGA TF-binding site. Yeast one-hybrid and GUS transactivation assays confirmed the interaction between the TwTPS27a/b promoters and the TwTGA1 TF (a MeJA-inducible TGA TF upregulating triptolide biosynthesis in T. wilfordii), indicating that TwTPS27a/b are two target genes regulated by TwTGA1. In conclusion, our results provide important information for elucidating the regulatory mechanism of MS genes, TwTPS27a and TwTPS27b, as two target genes of TwTGA1, in jasmonic acid (JA)-inducible triptolide biosynthesis. MDPI 2021-02-23 /pmc/articles/PMC7926782/ /pubmed/33672407 http://dx.doi.org/10.3390/plants10020418 Text en © 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Huo, Yanbo
Zhang, Bin
Chen, Ling
Zhang, Jing
Zhang, Xing
Zhu, Chuanshu
Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title_full Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title_fullStr Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title_full_unstemmed Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title_short Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
title_sort isolation and functional characterization of the promoters of miltiradiene synthase genes, twtps27a and twtps27b, and interaction analysis with the transcription factor twtga1 from tripterygium wilfordii
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7926782/
https://www.ncbi.nlm.nih.gov/pubmed/33672407
http://dx.doi.org/10.3390/plants10020418
work_keys_str_mv AT huoyanbo isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii
AT zhangbin isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii
AT chenling isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii
AT zhangjing isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii
AT zhangxing isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii
AT zhuchuanshu isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii