Cargando…
Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii
Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide bios...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7926782/ https://www.ncbi.nlm.nih.gov/pubmed/33672407 http://dx.doi.org/10.3390/plants10020418 |
_version_ | 1783659541147156480 |
---|---|
author | Huo, Yanbo Zhang, Bin Chen, Ling Zhang, Jing Zhang, Xing Zhu, Chuanshu |
author_facet | Huo, Yanbo Zhang, Bin Chen, Ling Zhang, Jing Zhang, Xing Zhu, Chuanshu |
author_sort | Huo, Yanbo |
collection | PubMed |
description | Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide biosynthesis remains unclear. In this study, the promoters of TwTPS27a (1496 bp) and TwTPS27b (1862 bp) were isolated and analyzed. Some hormone-/stress-responsive elements and transcription factor (TF) binding sites were predicted in both promoters, which might be responsible for the regulation mechanism of TwTPS27a/b. The β-glucuronidase (GUS) activity analysis in promoter deletion assays under normal and methyl jasmonate (MeJA) conditions showed that the sequence of −921 to −391 bp is the potential core region of the TwTPS27b promoter. And the TGACG-motif, a MeJA-responsive element found in this core region, might be responsible for MeJA-mediated stress induction of GUS activity. Moreover, the TGACG-motif is also known as the TGA TF-binding site. Yeast one-hybrid and GUS transactivation assays confirmed the interaction between the TwTPS27a/b promoters and the TwTGA1 TF (a MeJA-inducible TGA TF upregulating triptolide biosynthesis in T. wilfordii), indicating that TwTPS27a/b are two target genes regulated by TwTGA1. In conclusion, our results provide important information for elucidating the regulatory mechanism of MS genes, TwTPS27a and TwTPS27b, as two target genes of TwTGA1, in jasmonic acid (JA)-inducible triptolide biosynthesis. |
format | Online Article Text |
id | pubmed-7926782 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-79267822021-03-04 Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii Huo, Yanbo Zhang, Bin Chen, Ling Zhang, Jing Zhang, Xing Zhu, Chuanshu Plants (Basel) Article Miltiradiene synthase (MS) genes, TwTPS27a and TwTPS27b, are the key diterpene synthase genes in the biosynthesis of triptolide, which is an important medicinally active diterpenoid in Tripterygium wilfordii. However, the mechanism underlying the regulation of key genes TwTPS27a/b in triptolide biosynthesis remains unclear. In this study, the promoters of TwTPS27a (1496 bp) and TwTPS27b (1862 bp) were isolated and analyzed. Some hormone-/stress-responsive elements and transcription factor (TF) binding sites were predicted in both promoters, which might be responsible for the regulation mechanism of TwTPS27a/b. The β-glucuronidase (GUS) activity analysis in promoter deletion assays under normal and methyl jasmonate (MeJA) conditions showed that the sequence of −921 to −391 bp is the potential core region of the TwTPS27b promoter. And the TGACG-motif, a MeJA-responsive element found in this core region, might be responsible for MeJA-mediated stress induction of GUS activity. Moreover, the TGACG-motif is also known as the TGA TF-binding site. Yeast one-hybrid and GUS transactivation assays confirmed the interaction between the TwTPS27a/b promoters and the TwTGA1 TF (a MeJA-inducible TGA TF upregulating triptolide biosynthesis in T. wilfordii), indicating that TwTPS27a/b are two target genes regulated by TwTGA1. In conclusion, our results provide important information for elucidating the regulatory mechanism of MS genes, TwTPS27a and TwTPS27b, as two target genes of TwTGA1, in jasmonic acid (JA)-inducible triptolide biosynthesis. MDPI 2021-02-23 /pmc/articles/PMC7926782/ /pubmed/33672407 http://dx.doi.org/10.3390/plants10020418 Text en © 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Huo, Yanbo Zhang, Bin Chen, Ling Zhang, Jing Zhang, Xing Zhu, Chuanshu Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title | Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title_full | Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title_fullStr | Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title_full_unstemmed | Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title_short | Isolation and Functional Characterization of the Promoters of Miltiradiene Synthase Genes, TwTPS27a and TwTPS27b, and Interaction Analysis with the Transcription Factor TwTGA1 from Tripterygium wilfordii |
title_sort | isolation and functional characterization of the promoters of miltiradiene synthase genes, twtps27a and twtps27b, and interaction analysis with the transcription factor twtga1 from tripterygium wilfordii |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7926782/ https://www.ncbi.nlm.nih.gov/pubmed/33672407 http://dx.doi.org/10.3390/plants10020418 |
work_keys_str_mv | AT huoyanbo isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii AT zhangbin isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii AT chenling isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii AT zhangjing isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii AT zhangxing isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii AT zhuchuanshu isolationandfunctionalcharacterizationofthepromotersofmiltiradienesynthasegenestwtps27aandtwtps27bandinteractionanalysiswiththetranscriptionfactortwtga1fromtripterygiumwilfordii |