Cargando…
Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review
BACKGROUND: Hospital-based kangaroo mother care can help reduce preventable newborn deaths and has been recommended by the World Health Organization in the care of low birthweight babies weighing 2000 g or less. However, implementation has been limited. The objective of this review is to understand...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7934357/ https://www.ncbi.nlm.nih.gov/pubmed/33663415 http://dx.doi.org/10.1186/s12884-021-03646-3 |
_version_ | 1783660797078011904 |
---|---|
author | Kinshella, Mai-Lei Woo Hiwa, Tamanda Pickerill, Kelly Vidler, Marianne Dube, Queen Goldfarb, David Nyondo-Mipando, Alinane Linda Kawaza, Kondwani |
author_facet | Kinshella, Mai-Lei Woo Hiwa, Tamanda Pickerill, Kelly Vidler, Marianne Dube, Queen Goldfarb, David Nyondo-Mipando, Alinane Linda Kawaza, Kondwani |
author_sort | Kinshella, Mai-Lei Woo |
collection | PubMed |
description | BACKGROUND: Hospital-based kangaroo mother care can help reduce preventable newborn deaths and has been recommended by the World Health Organization in the care of low birthweight babies weighing 2000 g or less. However, implementation has been limited. The objective of this review is to understand the barriers and facilitators of kangaroo mother care implementation in health facilities in sub-Saharan Africa, where there are the highest rates of neonatal mortality in the world. METHODS: A systematic search was performed on MEDLINE, Web of Science, Cumulative Index to Nursing and Allied Health, African Journals Online, African Index Medicus as well as the references of relevant articles. Inclusion criteria included primary research, facility-based kangaroo mother care in sub-Saharan Africa. Studies were assessed by the Critical Appraisal Skills Programme Qualitative Checklist and the National Institutes of Health quality assessment tools and underwent narrative synthesis. RESULTS: Thirty studies were included in the review. This review examined barriers and facilitators to kangaroo mother care practice at health systems level, health worker experiences and perspectives of mothers and their families. Strong local leadership was essential to overcome barriers of inadequate space, limited budget for supplies, inadequate staffing, lack of guidelines and policies and insufficient supportive supervision. Workload burdens, knowledge gaps and staff attitudes were highlighted as challenges at health workers’ level, which could be supported by sharing of best practices and success stories. Support for mothers and their families was also identified as a gap. CONCLUSION: Building momentum for kangaroo mother care in health facilities in sub-Saharan Africa continues to be a challenge. Strengthening health systems and communication, prioritizing preterm infant care in public health strategies and supporting health workers and mothers and their families as partners in care are important to scale up. This will support sustainable kangaroo mother care implementation as well as strengthen quality of newborn care overall. PROSPERO registration: CRD42020166742. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12884-021-03646-3. |
format | Online Article Text |
id | pubmed-7934357 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-79343572021-03-08 Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review Kinshella, Mai-Lei Woo Hiwa, Tamanda Pickerill, Kelly Vidler, Marianne Dube, Queen Goldfarb, David Nyondo-Mipando, Alinane Linda Kawaza, Kondwani BMC Pregnancy Childbirth Research Article BACKGROUND: Hospital-based kangaroo mother care can help reduce preventable newborn deaths and has been recommended by the World Health Organization in the care of low birthweight babies weighing 2000 g or less. However, implementation has been limited. The objective of this review is to understand the barriers and facilitators of kangaroo mother care implementation in health facilities in sub-Saharan Africa, where there are the highest rates of neonatal mortality in the world. METHODS: A systematic search was performed on MEDLINE, Web of Science, Cumulative Index to Nursing and Allied Health, African Journals Online, African Index Medicus as well as the references of relevant articles. Inclusion criteria included primary research, facility-based kangaroo mother care in sub-Saharan Africa. Studies were assessed by the Critical Appraisal Skills Programme Qualitative Checklist and the National Institutes of Health quality assessment tools and underwent narrative synthesis. RESULTS: Thirty studies were included in the review. This review examined barriers and facilitators to kangaroo mother care practice at health systems level, health worker experiences and perspectives of mothers and their families. Strong local leadership was essential to overcome barriers of inadequate space, limited budget for supplies, inadequate staffing, lack of guidelines and policies and insufficient supportive supervision. Workload burdens, knowledge gaps and staff attitudes were highlighted as challenges at health workers’ level, which could be supported by sharing of best practices and success stories. Support for mothers and their families was also identified as a gap. CONCLUSION: Building momentum for kangaroo mother care in health facilities in sub-Saharan Africa continues to be a challenge. Strengthening health systems and communication, prioritizing preterm infant care in public health strategies and supporting health workers and mothers and their families as partners in care are important to scale up. This will support sustainable kangaroo mother care implementation as well as strengthen quality of newborn care overall. PROSPERO registration: CRD42020166742. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12884-021-03646-3. BioMed Central 2021-03-04 /pmc/articles/PMC7934357/ /pubmed/33663415 http://dx.doi.org/10.1186/s12884-021-03646-3 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Kinshella, Mai-Lei Woo Hiwa, Tamanda Pickerill, Kelly Vidler, Marianne Dube, Queen Goldfarb, David Nyondo-Mipando, Alinane Linda Kawaza, Kondwani Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title | Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title_full | Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title_fullStr | Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title_short | Barriers and facilitators of facility-based kangaroo mother care in sub-Saharan Africa: a systematic review |
title_sort | barriers and facilitators of facility-based kangaroo mother care in sub-saharan africa: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7934357/ https://www.ncbi.nlm.nih.gov/pubmed/33663415 http://dx.doi.org/10.1186/s12884-021-03646-3 |
work_keys_str_mv | AT kinshellamaileiwoo barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT hiwatamanda barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT pickerillkelly barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT vidlermarianne barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT dubequeen barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT goldfarbdavid barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT nyondomipandoalinanelinda barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview AT kawazakondwani barriersandfacilitatorsoffacilitybasedkangaroomothercareinsubsaharanafricaasystematicreview |