Cargando…
Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury
BACKGROUND: Bone marrow-derived mesenchymal stem cells (BMSCs) have been shown to have some beneficial effects in acute lung injury (ALI), but the therapeutic effects are limited due to apoptosis or necrosis after transplantation into injured lungs. Here, we aim to explore whether Non-muscle myosin...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
AME Publishing Company
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7940885/ https://www.ncbi.nlm.nih.gov/pubmed/33708889 http://dx.doi.org/10.21037/atm-20-4851 |
_version_ | 1783662038352920576 |
---|---|
author | Wu, Guosheng Chang, Fei Fang, He Zheng, Xingfeng Zhuang, Mingzhu Liu, Xiaobin Hou, Wenjia Xu, Long Chen, Zhengli Tang, Chenqi Wu, Yu Sun, Yu Zhu, Feng |
author_facet | Wu, Guosheng Chang, Fei Fang, He Zheng, Xingfeng Zhuang, Mingzhu Liu, Xiaobin Hou, Wenjia Xu, Long Chen, Zhengli Tang, Chenqi Wu, Yu Sun, Yu Zhu, Feng |
author_sort | Wu, Guosheng |
collection | PubMed |
description | BACKGROUND: Bone marrow-derived mesenchymal stem cells (BMSCs) have been shown to have some beneficial effects in acute lung injury (ALI), but the therapeutic effects are limited due to apoptosis or necrosis after transplantation into injured lungs. Here, we aim to explore whether Non-muscle myosin II (NM-II) knockdown could enhance BMSCs survival and improve therapeutic effects in ALI. METHODS: MSCs, isolated from rat bone marrow, were transfected with the small interfering RNA (siRNA) targeted to NM-II mRNA by a lentivirus vector. Rats were equally randomized to four groups: the control group was given normal saline via tail vein; the other three groups underwent intratracheal lipopolysaccharide (LPS) instillation followed by administration with either normal saline, BMSCs transduced with lentivirus-enhanced green fluorescent protein (eGFP) empty vector, or BMSCs transduced with lentivirus-eGFP NM-II siRNA. Hematoxylin and eosin staining was used to evaluate lung histopathologic changes and Masson trichrome staining was used to assess lung fibrosis. The myeloperoxidase activity was also tested in lung tissues. The mRNA expression of inflammatory cytokines in lung tissues was determined via quantitative reverse transcription PCR. Sex-determining region of the Y chromosome gene expression was measured by fluorescence in situ hybridization (FISH) assay. The expression of self-renewal activity and apoptosis-associated proteins were measured by Western blot. RESULTS: Transplantation of NM-II siRNA-modified BMSCs could improve histopathological morphology, decrease inflammatory infiltrates, down-regulate the expression levels of inflammatory cytokines, and reduce pulmonary interstitial edema. NM-II siRNA-modified BMSCs showed antifibrotic properties and alleviated the degrees of pulmonary fibrosis induced by endotoxin. In addition, NM-II knockdown BMSCs showed slightly better therapeutic effect on lung inflammation when compared with control BMSCs. The beneficial effects of NM-II siRNA-modified BMSCs may be attributed to enhanced self-renewal activity and decreased apoptosis. CONCLUSIONS: NM-II knockdown could inhibit the apoptosis of implanted BMSCs in lung tissues and improve its self-renewal activity. NM-II siRNA-modified BMSCs have a slightly enhanced ability to attenuate lung injury after LPS challenge. |
format | Online Article Text |
id | pubmed-7940885 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | AME Publishing Company |
record_format | MEDLINE/PubMed |
spelling | pubmed-79408852021-03-10 Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury Wu, Guosheng Chang, Fei Fang, He Zheng, Xingfeng Zhuang, Mingzhu Liu, Xiaobin Hou, Wenjia Xu, Long Chen, Zhengli Tang, Chenqi Wu, Yu Sun, Yu Zhu, Feng Ann Transl Med Original Article BACKGROUND: Bone marrow-derived mesenchymal stem cells (BMSCs) have been shown to have some beneficial effects in acute lung injury (ALI), but the therapeutic effects are limited due to apoptosis or necrosis after transplantation into injured lungs. Here, we aim to explore whether Non-muscle myosin II (NM-II) knockdown could enhance BMSCs survival and improve therapeutic effects in ALI. METHODS: MSCs, isolated from rat bone marrow, were transfected with the small interfering RNA (siRNA) targeted to NM-II mRNA by a lentivirus vector. Rats were equally randomized to four groups: the control group was given normal saline via tail vein; the other three groups underwent intratracheal lipopolysaccharide (LPS) instillation followed by administration with either normal saline, BMSCs transduced with lentivirus-enhanced green fluorescent protein (eGFP) empty vector, or BMSCs transduced with lentivirus-eGFP NM-II siRNA. Hematoxylin and eosin staining was used to evaluate lung histopathologic changes and Masson trichrome staining was used to assess lung fibrosis. The myeloperoxidase activity was also tested in lung tissues. The mRNA expression of inflammatory cytokines in lung tissues was determined via quantitative reverse transcription PCR. Sex-determining region of the Y chromosome gene expression was measured by fluorescence in situ hybridization (FISH) assay. The expression of self-renewal activity and apoptosis-associated proteins were measured by Western blot. RESULTS: Transplantation of NM-II siRNA-modified BMSCs could improve histopathological morphology, decrease inflammatory infiltrates, down-regulate the expression levels of inflammatory cytokines, and reduce pulmonary interstitial edema. NM-II siRNA-modified BMSCs showed antifibrotic properties and alleviated the degrees of pulmonary fibrosis induced by endotoxin. In addition, NM-II knockdown BMSCs showed slightly better therapeutic effect on lung inflammation when compared with control BMSCs. The beneficial effects of NM-II siRNA-modified BMSCs may be attributed to enhanced self-renewal activity and decreased apoptosis. CONCLUSIONS: NM-II knockdown could inhibit the apoptosis of implanted BMSCs in lung tissues and improve its self-renewal activity. NM-II siRNA-modified BMSCs have a slightly enhanced ability to attenuate lung injury after LPS challenge. AME Publishing Company 2021-02 /pmc/articles/PMC7940885/ /pubmed/33708889 http://dx.doi.org/10.21037/atm-20-4851 Text en 2021 Annals of Translational Medicine. All rights reserved. https://creativecommons.org/licenses/by-nc-nd/4.0/Open Access Statement: This is an Open Access article distributed in accordance with the Creative Commons Attribution-NonCommercial-NoDerivs 4.0 International License (CC BY-NC-ND 4.0), which permits the non-commercial replication and distribution of the article with the strict proviso that no changes or edits are made and the original work is properly cited (including links to both the formal publication through the relevant DOI and the license). See: https://creativecommons.org/licenses/by-nc-nd/4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) . |
spellingShingle | Original Article Wu, Guosheng Chang, Fei Fang, He Zheng, Xingfeng Zhuang, Mingzhu Liu, Xiaobin Hou, Wenjia Xu, Long Chen, Zhengli Tang, Chenqi Wu, Yu Sun, Yu Zhu, Feng Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title | Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title_full | Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title_fullStr | Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title_full_unstemmed | Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title_short | Non-muscle myosin II knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
title_sort | non-muscle myosin ii knockdown improves survival and therapeutic effects of implanted bone marrow-derived mesenchymal stem cells in lipopolysaccharide-induced acute lung injury |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7940885/ https://www.ncbi.nlm.nih.gov/pubmed/33708889 http://dx.doi.org/10.21037/atm-20-4851 |
work_keys_str_mv | AT wuguosheng nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT changfei nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT fanghe nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT zhengxingfeng nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT zhuangmingzhu nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT liuxiaobin nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT houwenjia nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT xulong nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT chenzhengli nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT tangchenqi nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT wuyu nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT sunyu nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury AT zhufeng nonmusclemyosiniiknockdownimprovessurvivalandtherapeuticeffectsofimplantedbonemarrowderivedmesenchymalstemcellsinlipopolysaccharideinducedacutelunginjury |