Cargando…

Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey

BACKGROUND: There is mounting evidence on the existence of a Pediatric Inflammatory Multisystem Syndrome-temporally associated to SARS-CoV-2 infection (PIMS-TS), sharing similarities with Kawasaki Disease (KD). The main outcome of the study were to better characterize the clinical features and the t...

Descripción completa

Detalles Bibliográficos
Autores principales: Cattalini, Marco, Della Paolera, Sara, Zunica, Fiammetta, Bracaglia, Claudia, Giangreco, Manuela, Verdoni, Lucio, Meini, Antonella, Sottile, Rita, Caorsi, Roberta, Zuccotti, Gianvincenzo, Fabi, Marianna, Montin, Davide, Meneghel, Alessandra, Consolaro, Alessandro, Dellepiane, Rosa Maria, Maggio, Maria Cristina, La Torre, Francesco, Marchesi, Alessandra, Simonini, Gabriele, Villani, Alberto, Cimaz, Rolando, Ravelli, Angelo, Taddio, Andrea
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7962084/
https://www.ncbi.nlm.nih.gov/pubmed/33726806
http://dx.doi.org/10.1186/s12969-021-00511-7
_version_ 1783665401308119040
author Cattalini, Marco
Della Paolera, Sara
Zunica, Fiammetta
Bracaglia, Claudia
Giangreco, Manuela
Verdoni, Lucio
Meini, Antonella
Sottile, Rita
Caorsi, Roberta
Zuccotti, Gianvincenzo
Fabi, Marianna
Montin, Davide
Meneghel, Alessandra
Consolaro, Alessandro
Dellepiane, Rosa Maria
Maggio, Maria Cristina
La Torre, Francesco
Marchesi, Alessandra
Simonini, Gabriele
Villani, Alberto
Cimaz, Rolando
Ravelli, Angelo
Taddio, Andrea
author_facet Cattalini, Marco
Della Paolera, Sara
Zunica, Fiammetta
Bracaglia, Claudia
Giangreco, Manuela
Verdoni, Lucio
Meini, Antonella
Sottile, Rita
Caorsi, Roberta
Zuccotti, Gianvincenzo
Fabi, Marianna
Montin, Davide
Meneghel, Alessandra
Consolaro, Alessandro
Dellepiane, Rosa Maria
Maggio, Maria Cristina
La Torre, Francesco
Marchesi, Alessandra
Simonini, Gabriele
Villani, Alberto
Cimaz, Rolando
Ravelli, Angelo
Taddio, Andrea
author_sort Cattalini, Marco
collection PubMed
description BACKGROUND: There is mounting evidence on the existence of a Pediatric Inflammatory Multisystem Syndrome-temporally associated to SARS-CoV-2 infection (PIMS-TS), sharing similarities with Kawasaki Disease (KD). The main outcome of the study were to better characterize the clinical features and the treatment response of PIMS-TS and to explore its relationship with KD determining whether KD and PIMS are two distinct entities. METHODS: The Rheumatology Study Group of the Italian Pediatric Society launched a survey to enroll patients diagnosed with KD (Kawasaki Disease Group – KDG) or KD-like (Kawacovid Group - KCG) disease between February 1st 2020, and May 31st 2020. Demographic, clinical, laboratory data, treatment information, and patients’ outcome were collected in an online anonymized database (RedCAP®). Relationship between clinical presentation and SARS-CoV-2 infection was also taken into account. Moreover, clinical characteristics of KDG during SARS-CoV-2 epidemic (KDG-CoV2) were compared to Kawasaki Disease patients (KDG-Historical) seen in three different Italian tertiary pediatric hospitals (Institute for Maternal and Child Health, IRCCS “Burlo Garofolo”, Trieste; AOU Meyer, Florence; IRCCS Istituto Giannina Gaslini, Genoa) from January 1st 2000 to December 31st 2019. Chi square test or exact Fisher test and non-parametric Wilcoxon Mann-Whitney test were used to study differences between two groups. RESULTS: One-hundred-forty-nine cases were enrolled, (96 KDG and 53 KCG). KCG children were significantly older and presented more frequently from gastrointestinal and respiratory involvement. Cardiac involvement was more common in KCG, with 60,4% of patients with myocarditis. 37,8% of patients among KCG presented hypotension/non-cardiogenic shock. Coronary artery abnormalities (CAA) were more common in the KDG. The risk of ICU admission were higher in KCG. Lymphopenia, higher CRP levels, elevated ferritin and troponin-T characterized KCG. KDG received more frequently immunoglobulins (IVIG) and acetylsalicylic acid (ASA) (81,3% vs 66%; p = 0.04 and 71,9% vs 43,4%; p = 0.001 respectively) as KCG more often received glucocorticoids (56,6% vs 14,6%; p < 0.0001). SARS-CoV-2 assay more often resulted positive in KCG than in KDG (75,5% vs 20%; p < 0.0001). Short-term follow data showed minor complications. Comparing KDG with a KD-Historical Italian cohort (598 patients), no statistical difference was found in terms of clinical manifestations and laboratory data. CONCLUSION: Our study suggests that SARS-CoV-2 infection might determine two distinct inflammatory diseases in children: KD and PIMS-TS. Older age at onset and clinical peculiarities like the occurrence of myocarditis characterize this multi-inflammatory syndrome. Our patients had an optimal response to treatments and a good outcome, with few complications and no deaths. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12969-021-00511-7.
format Online
Article
Text
id pubmed-7962084
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-79620842021-03-16 Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey Cattalini, Marco Della Paolera, Sara Zunica, Fiammetta Bracaglia, Claudia Giangreco, Manuela Verdoni, Lucio Meini, Antonella Sottile, Rita Caorsi, Roberta Zuccotti, Gianvincenzo Fabi, Marianna Montin, Davide Meneghel, Alessandra Consolaro, Alessandro Dellepiane, Rosa Maria Maggio, Maria Cristina La Torre, Francesco Marchesi, Alessandra Simonini, Gabriele Villani, Alberto Cimaz, Rolando Ravelli, Angelo Taddio, Andrea Pediatr Rheumatol Online J Research Article BACKGROUND: There is mounting evidence on the existence of a Pediatric Inflammatory Multisystem Syndrome-temporally associated to SARS-CoV-2 infection (PIMS-TS), sharing similarities with Kawasaki Disease (KD). The main outcome of the study were to better characterize the clinical features and the treatment response of PIMS-TS and to explore its relationship with KD determining whether KD and PIMS are two distinct entities. METHODS: The Rheumatology Study Group of the Italian Pediatric Society launched a survey to enroll patients diagnosed with KD (Kawasaki Disease Group – KDG) or KD-like (Kawacovid Group - KCG) disease between February 1st 2020, and May 31st 2020. Demographic, clinical, laboratory data, treatment information, and patients’ outcome were collected in an online anonymized database (RedCAP®). Relationship between clinical presentation and SARS-CoV-2 infection was also taken into account. Moreover, clinical characteristics of KDG during SARS-CoV-2 epidemic (KDG-CoV2) were compared to Kawasaki Disease patients (KDG-Historical) seen in three different Italian tertiary pediatric hospitals (Institute for Maternal and Child Health, IRCCS “Burlo Garofolo”, Trieste; AOU Meyer, Florence; IRCCS Istituto Giannina Gaslini, Genoa) from January 1st 2000 to December 31st 2019. Chi square test or exact Fisher test and non-parametric Wilcoxon Mann-Whitney test were used to study differences between two groups. RESULTS: One-hundred-forty-nine cases were enrolled, (96 KDG and 53 KCG). KCG children were significantly older and presented more frequently from gastrointestinal and respiratory involvement. Cardiac involvement was more common in KCG, with 60,4% of patients with myocarditis. 37,8% of patients among KCG presented hypotension/non-cardiogenic shock. Coronary artery abnormalities (CAA) were more common in the KDG. The risk of ICU admission were higher in KCG. Lymphopenia, higher CRP levels, elevated ferritin and troponin-T characterized KCG. KDG received more frequently immunoglobulins (IVIG) and acetylsalicylic acid (ASA) (81,3% vs 66%; p = 0.04 and 71,9% vs 43,4%; p = 0.001 respectively) as KCG more often received glucocorticoids (56,6% vs 14,6%; p < 0.0001). SARS-CoV-2 assay more often resulted positive in KCG than in KDG (75,5% vs 20%; p < 0.0001). Short-term follow data showed minor complications. Comparing KDG with a KD-Historical Italian cohort (598 patients), no statistical difference was found in terms of clinical manifestations and laboratory data. CONCLUSION: Our study suggests that SARS-CoV-2 infection might determine two distinct inflammatory diseases in children: KD and PIMS-TS. Older age at onset and clinical peculiarities like the occurrence of myocarditis characterize this multi-inflammatory syndrome. Our patients had an optimal response to treatments and a good outcome, with few complications and no deaths. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12969-021-00511-7. BioMed Central 2021-03-16 /pmc/articles/PMC7962084/ /pubmed/33726806 http://dx.doi.org/10.1186/s12969-021-00511-7 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Cattalini, Marco
Della Paolera, Sara
Zunica, Fiammetta
Bracaglia, Claudia
Giangreco, Manuela
Verdoni, Lucio
Meini, Antonella
Sottile, Rita
Caorsi, Roberta
Zuccotti, Gianvincenzo
Fabi, Marianna
Montin, Davide
Meneghel, Alessandra
Consolaro, Alessandro
Dellepiane, Rosa Maria
Maggio, Maria Cristina
La Torre, Francesco
Marchesi, Alessandra
Simonini, Gabriele
Villani, Alberto
Cimaz, Rolando
Ravelli, Angelo
Taddio, Andrea
Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title_full Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title_fullStr Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title_full_unstemmed Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title_short Defining Kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to SARS-CoV-2 infection during SARS-CoV-2 epidemic in Italy: results from a national, multicenter survey
title_sort defining kawasaki disease and pediatric inflammatory multisystem syndrome-temporally associated to sars-cov-2 infection during sars-cov-2 epidemic in italy: results from a national, multicenter survey
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7962084/
https://www.ncbi.nlm.nih.gov/pubmed/33726806
http://dx.doi.org/10.1186/s12969-021-00511-7
work_keys_str_mv AT cattalinimarco definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT dellapaolerasara definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT zunicafiammetta definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT bracagliaclaudia definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT giangrecomanuela definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT verdonilucio definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT meiniantonella definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT sottilerita definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT caorsiroberta definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT zuccottigianvincenzo definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT fabimarianna definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT montindavide definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT meneghelalessandra definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT consolaroalessandro definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT dellepianerosamaria definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT maggiomariacristina definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT latorrefrancesco definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT marchesialessandra definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT simoninigabriele definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT villanialberto definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT cimazrolando definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT ravelliangelo definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT taddioandrea definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey
AT definingkawasakidiseaseandpediatricinflammatorymultisystemsyndrometemporallyassociatedtosarscov2infectionduringsarscov2epidemicinitalyresultsfromanationalmulticentersurvey