Cargando…

Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury

BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the relate...

Descripción completa

Detalles Bibliográficos
Autores principales: Azami-Aghdash, Saber, Moosavi, Ahmad, Gharaee, Hojatolah, Sadeghi, Ghader, Mousavi Isfahani, Haleh, Ghasemi Dastgerdi, Alireza, Mohseni, Mohammad
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7970773/
https://www.ncbi.nlm.nih.gov/pubmed/33726709
http://dx.doi.org/10.1186/s12913-021-06238-1
_version_ 1783666477716471808
author Azami-Aghdash, Saber
Moosavi, Ahmad
Gharaee, Hojatolah
Sadeghi, Ghader
Mousavi Isfahani, Haleh
Ghasemi Dastgerdi, Alireza
Mohseni, Mohammad
author_facet Azami-Aghdash, Saber
Moosavi, Ahmad
Gharaee, Hojatolah
Sadeghi, Ghader
Mousavi Isfahani, Haleh
Ghasemi Dastgerdi, Alireza
Mohseni, Mohammad
author_sort Azami-Aghdash, Saber
collection PubMed
description BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the related literature review, 14 experts were interviewed through semi-structured interviews to identify Quality Measurement Indicators (QMIs). The extracted indicators were then categorized into three domains: structure, performance, and management. Finally, the identified QMIs were confirmed through two rounds of the Delphi technique. RESULTS: Using literature review 11 structural, 13 performance, and four managerial indicators (A total of 28 indicators) were identified. Also, four structural, four performance, and three managerial indicators (A total of 11indicators) were extracted from interviews with experts. Two indicators were excluded after two rounds of Delphi’s technics. Finally, 14 structural, 16 performance and, seven managerial indicators (A total of 37indicators) were finalized. CONCLUSION: Due to the importance and high proportion of RTIs compared to other types of injuries, this study set out to design and evaluate the QMIs of PEC delivered for RTIs. The findings of this research contribute to measuring and planning aimed at improving the performance of PEC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06238-1.
format Online
Article
Text
id pubmed-7970773
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-79707732021-03-19 Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury Azami-Aghdash, Saber Moosavi, Ahmad Gharaee, Hojatolah Sadeghi, Ghader Mousavi Isfahani, Haleh Ghasemi Dastgerdi, Alireza Mohseni, Mohammad BMC Health Serv Res Research Article BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the related literature review, 14 experts were interviewed through semi-structured interviews to identify Quality Measurement Indicators (QMIs). The extracted indicators were then categorized into three domains: structure, performance, and management. Finally, the identified QMIs were confirmed through two rounds of the Delphi technique. RESULTS: Using literature review 11 structural, 13 performance, and four managerial indicators (A total of 28 indicators) were identified. Also, four structural, four performance, and three managerial indicators (A total of 11indicators) were extracted from interviews with experts. Two indicators were excluded after two rounds of Delphi’s technics. Finally, 14 structural, 16 performance and, seven managerial indicators (A total of 37indicators) were finalized. CONCLUSION: Due to the importance and high proportion of RTIs compared to other types of injuries, this study set out to design and evaluate the QMIs of PEC delivered for RTIs. The findings of this research contribute to measuring and planning aimed at improving the performance of PEC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06238-1. BioMed Central 2021-03-16 /pmc/articles/PMC7970773/ /pubmed/33726709 http://dx.doi.org/10.1186/s12913-021-06238-1 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Azami-Aghdash, Saber
Moosavi, Ahmad
Gharaee, Hojatolah
Sadeghi, Ghader
Mousavi Isfahani, Haleh
Ghasemi Dastgerdi, Alireza
Mohseni, Mohammad
Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title_full Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title_fullStr Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title_full_unstemmed Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title_short Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
title_sort development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7970773/
https://www.ncbi.nlm.nih.gov/pubmed/33726709
http://dx.doi.org/10.1186/s12913-021-06238-1
work_keys_str_mv AT azamiaghdashsaber developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT moosaviahmad developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT gharaeehojatolah developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT sadeghighader developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT mousaviisfahanihaleh developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT ghasemidastgerdialireza developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury
AT mohsenimohammad developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury