Cargando…
Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury
BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the relate...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7970773/ https://www.ncbi.nlm.nih.gov/pubmed/33726709 http://dx.doi.org/10.1186/s12913-021-06238-1 |
_version_ | 1783666477716471808 |
---|---|
author | Azami-Aghdash, Saber Moosavi, Ahmad Gharaee, Hojatolah Sadeghi, Ghader Mousavi Isfahani, Haleh Ghasemi Dastgerdi, Alireza Mohseni, Mohammad |
author_facet | Azami-Aghdash, Saber Moosavi, Ahmad Gharaee, Hojatolah Sadeghi, Ghader Mousavi Isfahani, Haleh Ghasemi Dastgerdi, Alireza Mohseni, Mohammad |
author_sort | Azami-Aghdash, Saber |
collection | PubMed |
description | BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the related literature review, 14 experts were interviewed through semi-structured interviews to identify Quality Measurement Indicators (QMIs). The extracted indicators were then categorized into three domains: structure, performance, and management. Finally, the identified QMIs were confirmed through two rounds of the Delphi technique. RESULTS: Using literature review 11 structural, 13 performance, and four managerial indicators (A total of 28 indicators) were identified. Also, four structural, four performance, and three managerial indicators (A total of 11indicators) were extracted from interviews with experts. Two indicators were excluded after two rounds of Delphi’s technics. Finally, 14 structural, 16 performance and, seven managerial indicators (A total of 37indicators) were finalized. CONCLUSION: Due to the importance and high proportion of RTIs compared to other types of injuries, this study set out to design and evaluate the QMIs of PEC delivered for RTIs. The findings of this research contribute to measuring and planning aimed at improving the performance of PEC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06238-1. |
format | Online Article Text |
id | pubmed-7970773 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-79707732021-03-19 Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury Azami-Aghdash, Saber Moosavi, Ahmad Gharaee, Hojatolah Sadeghi, Ghader Mousavi Isfahani, Haleh Ghasemi Dastgerdi, Alireza Mohseni, Mohammad BMC Health Serv Res Research Article BACKGROUND: Pre-Hospital Emergency Care (PEC) is a fundamental property of prevention of Road Traffic Injuries (RTIs). Thus, this sector requires a system for evaluation and performance improvement. This study aimed to develop quality indicators to measure PEC for RTIs. METHODS: Following the related literature review, 14 experts were interviewed through semi-structured interviews to identify Quality Measurement Indicators (QMIs). The extracted indicators were then categorized into three domains: structure, performance, and management. Finally, the identified QMIs were confirmed through two rounds of the Delphi technique. RESULTS: Using literature review 11 structural, 13 performance, and four managerial indicators (A total of 28 indicators) were identified. Also, four structural, four performance, and three managerial indicators (A total of 11indicators) were extracted from interviews with experts. Two indicators were excluded after two rounds of Delphi’s technics. Finally, 14 structural, 16 performance and, seven managerial indicators (A total of 37indicators) were finalized. CONCLUSION: Due to the importance and high proportion of RTIs compared to other types of injuries, this study set out to design and evaluate the QMIs of PEC delivered for RTIs. The findings of this research contribute to measuring and planning aimed at improving the performance of PEC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06238-1. BioMed Central 2021-03-16 /pmc/articles/PMC7970773/ /pubmed/33726709 http://dx.doi.org/10.1186/s12913-021-06238-1 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Azami-Aghdash, Saber Moosavi, Ahmad Gharaee, Hojatolah Sadeghi, Ghader Mousavi Isfahani, Haleh Ghasemi Dastgerdi, Alireza Mohseni, Mohammad Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title | Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title_full | Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title_fullStr | Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title_full_unstemmed | Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title_short | Development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
title_sort | development of quality indicators to measure pre-hospital emergency medical services for road traffic injury |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7970773/ https://www.ncbi.nlm.nih.gov/pubmed/33726709 http://dx.doi.org/10.1186/s12913-021-06238-1 |
work_keys_str_mv | AT azamiaghdashsaber developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT moosaviahmad developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT gharaeehojatolah developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT sadeghighader developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT mousaviisfahanihaleh developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT ghasemidastgerdialireza developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury AT mohsenimohammad developmentofqualityindicatorstomeasureprehospitalemergencymedicalservicesforroadtrafficinjury |