Cargando…

Nutritional perspectives on sickle cell disease in Africa: a systematic review

BACKGROUND: Sickle cell disease (SCD) is an inherited blood disorder that predominantly affects individuals in sub-Saharan Africa. However, research that elucidates links between SCD pathophysiology and nutritional status in African patients is lacking. This systematic review aimed to assess the lan...

Descripción completa

Detalles Bibliográficos
Autores principales: Nartey, Eunice Berko, Spector, Jonathan, Adu-Afarwuah, Seth, Jones, Catherine L., Jackson, Alan, Ohemeng, Agartha, Shah, Rajiv, Koryo-Dabrah, Alice, Kuma, Amma Benneh-Akwasi, Hyacinth, Hyacinth I., Steiner-Asiedu, Matilda
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7972183/
https://www.ncbi.nlm.nih.gov/pubmed/33731225
http://dx.doi.org/10.1186/s40795-021-00410-w
_version_ 1783666674962006016
author Nartey, Eunice Berko
Spector, Jonathan
Adu-Afarwuah, Seth
Jones, Catherine L.
Jackson, Alan
Ohemeng, Agartha
Shah, Rajiv
Koryo-Dabrah, Alice
Kuma, Amma Benneh-Akwasi
Hyacinth, Hyacinth I.
Steiner-Asiedu, Matilda
author_facet Nartey, Eunice Berko
Spector, Jonathan
Adu-Afarwuah, Seth
Jones, Catherine L.
Jackson, Alan
Ohemeng, Agartha
Shah, Rajiv
Koryo-Dabrah, Alice
Kuma, Amma Benneh-Akwasi
Hyacinth, Hyacinth I.
Steiner-Asiedu, Matilda
author_sort Nartey, Eunice Berko
collection PubMed
description BACKGROUND: Sickle cell disease (SCD) is an inherited blood disorder that predominantly affects individuals in sub-Saharan Africa. However, research that elucidates links between SCD pathophysiology and nutritional status in African patients is lacking. This systematic review aimed to assess the landscape of studies in sub-Saharan Africa that focused on nutritional aspects of SCD, and highlights gaps in knowledge that could inform priority-setting for future research. METHODS: The study was conducted using the Preferred Reporting Items for Systematic Reviews and Meta-Analysis (PRISMA) guidelines. Inclusion criteria comprised original, peer-reviewed research published between January 1995 and November 2020 involving individuals in Africa with any phenotypic variant of SCD and at least one nutritional status outcome. Nutritional status outcomes were defined as those that assessed dietary intakes, growth/anthropometry, or nutritional biomarkers. Databases used were Ovid Embase, Medline, Biosis and Web of Science. RESULTS: The search returned 526 articles, of which 76 were included in the final analyses. Most investigations (67%) were conducted in Nigeria. Studies were categorized into one of three main categories: descriptive studies of anthropometric characteristics (49%), descriptive studies of macro- or micronutrient status (41%), and interventional studies (11%). Findings consistently included growth impairment, especially among children and adolescents from sub-Saharan Africa. Studies assessing macro- and micronutrients generally had small sample sizes and were exploratory in nature. Only four randomized trials were identified, which measured the impact of lime juice, long-chain fatty acids supplementation, ready-to-use supplementary food (RUSF), and oral arginine on health outcomes. CONCLUSIONS: The findings reveal a moderate number of descriptive studies, most with small sample sizes, that focused on various aspects of nutrition and SCD in African patients. There was a stark dearth of interventional studies that could be used to inform evidence-based changes in clinical practice. Findings from the investigations were generally consistent with data from other regional settings, describing a significant risk of growth faltering and malnutrition among individuals with SCD. There is an unmet need for clinical research to better understand the potential benefits of nutrition-related interventions for patients with SCD in sub-Saharan Africa to promote optimal growth and improve health outcomes.
format Online
Article
Text
id pubmed-7972183
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-79721832021-03-19 Nutritional perspectives on sickle cell disease in Africa: a systematic review Nartey, Eunice Berko Spector, Jonathan Adu-Afarwuah, Seth Jones, Catherine L. Jackson, Alan Ohemeng, Agartha Shah, Rajiv Koryo-Dabrah, Alice Kuma, Amma Benneh-Akwasi Hyacinth, Hyacinth I. Steiner-Asiedu, Matilda BMC Nutr Research Article BACKGROUND: Sickle cell disease (SCD) is an inherited blood disorder that predominantly affects individuals in sub-Saharan Africa. However, research that elucidates links between SCD pathophysiology and nutritional status in African patients is lacking. This systematic review aimed to assess the landscape of studies in sub-Saharan Africa that focused on nutritional aspects of SCD, and highlights gaps in knowledge that could inform priority-setting for future research. METHODS: The study was conducted using the Preferred Reporting Items for Systematic Reviews and Meta-Analysis (PRISMA) guidelines. Inclusion criteria comprised original, peer-reviewed research published between January 1995 and November 2020 involving individuals in Africa with any phenotypic variant of SCD and at least one nutritional status outcome. Nutritional status outcomes were defined as those that assessed dietary intakes, growth/anthropometry, or nutritional biomarkers. Databases used were Ovid Embase, Medline, Biosis and Web of Science. RESULTS: The search returned 526 articles, of which 76 were included in the final analyses. Most investigations (67%) were conducted in Nigeria. Studies were categorized into one of three main categories: descriptive studies of anthropometric characteristics (49%), descriptive studies of macro- or micronutrient status (41%), and interventional studies (11%). Findings consistently included growth impairment, especially among children and adolescents from sub-Saharan Africa. Studies assessing macro- and micronutrients generally had small sample sizes and were exploratory in nature. Only four randomized trials were identified, which measured the impact of lime juice, long-chain fatty acids supplementation, ready-to-use supplementary food (RUSF), and oral arginine on health outcomes. CONCLUSIONS: The findings reveal a moderate number of descriptive studies, most with small sample sizes, that focused on various aspects of nutrition and SCD in African patients. There was a stark dearth of interventional studies that could be used to inform evidence-based changes in clinical practice. Findings from the investigations were generally consistent with data from other regional settings, describing a significant risk of growth faltering and malnutrition among individuals with SCD. There is an unmet need for clinical research to better understand the potential benefits of nutrition-related interventions for patients with SCD in sub-Saharan Africa to promote optimal growth and improve health outcomes. BioMed Central 2021-03-18 /pmc/articles/PMC7972183/ /pubmed/33731225 http://dx.doi.org/10.1186/s40795-021-00410-w Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Nartey, Eunice Berko
Spector, Jonathan
Adu-Afarwuah, Seth
Jones, Catherine L.
Jackson, Alan
Ohemeng, Agartha
Shah, Rajiv
Koryo-Dabrah, Alice
Kuma, Amma Benneh-Akwasi
Hyacinth, Hyacinth I.
Steiner-Asiedu, Matilda
Nutritional perspectives on sickle cell disease in Africa: a systematic review
title Nutritional perspectives on sickle cell disease in Africa: a systematic review
title_full Nutritional perspectives on sickle cell disease in Africa: a systematic review
title_fullStr Nutritional perspectives on sickle cell disease in Africa: a systematic review
title_full_unstemmed Nutritional perspectives on sickle cell disease in Africa: a systematic review
title_short Nutritional perspectives on sickle cell disease in Africa: a systematic review
title_sort nutritional perspectives on sickle cell disease in africa: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7972183/
https://www.ncbi.nlm.nih.gov/pubmed/33731225
http://dx.doi.org/10.1186/s40795-021-00410-w
work_keys_str_mv AT narteyeuniceberko nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT spectorjonathan nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT aduafarwuahseth nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT jonescatherinel nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT jacksonalan nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT ohemengagartha nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT shahrajiv nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT koryodabrahalice nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT kumaammabennehakwasi nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT hyacinthhyacinthi nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview
AT steinerasiedumatilda nutritionalperspectivesonsicklecelldiseaseinafricaasystematicreview