Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets

Campylobacter strains were collected in a survey of fresh chicken carcasses in Pennsylvania farmers’ markets. Three Campylobacter coli strains were observed to have unique sequence variations in their gyrase subunit B genes, compared with other Campylobacter strains. The strains were sequenced and a...

Descripción completa

Detalles Bibliográficos
Autores principales: Gunther, Nereus W., Kanrar, Siddhartha, Uhlich, Gaylen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2021
Materias:
Genome Sequences
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7975865/
https://www.ncbi.nlm.nih.gov/pubmed/33737347
http://dx.doi.org/10.1128/MRA.00015-21
_version_ 1783666980584161280
author Gunther, Nereus W.
Kanrar, Siddhartha
Uhlich, Gaylen
author_facet Gunther, Nereus W.
Kanrar, Siddhartha
Uhlich, Gaylen
author_sort Gunther, Nereus W.
collection PubMed
description Campylobacter strains were collected in a survey of fresh chicken carcasses in Pennsylvania farmers’ markets. Three Campylobacter coli strains were observed to have unique sequence variations in their gyrase subunit B genes, compared with other Campylobacter strains. The strains were sequenced and analyzed, producing genome sequences consisting of single closed chromosomes.
format Online
Article
Text
id pubmed-7975865
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-79758652021-04-09 Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets Gunther, Nereus W. Kanrar, Siddhartha Uhlich, Gaylen Microbiol Resour Announc Genome Sequences Campylobacter strains were collected in a survey of fresh chicken carcasses in Pennsylvania farmers’ markets. Three Campylobacter coli strains were observed to have unique sequence variations in their gyrase subunit B genes, compared with other Campylobacter strains. The strains were sequenced and analyzed, producing genome sequences consisting of single closed chromosomes. American Society for Microbiology 2021-03-18 /pmc/articles/PMC7975865/ /pubmed/33737347 http://dx.doi.org/10.1128/MRA.00015-21 Text en https://doi.org/10.1128/AuthorWarrantyLicense.v1 This is a work of the U.S. Government and is not subject to copyright protection in the United States. Foreign copyrights may apply.
spellingShingle Genome Sequences
Gunther, Nereus W.
Kanrar, Siddhartha
Uhlich, Gaylen
Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title_full Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title_fullStr Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title_full_unstemmed Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title_short Complete Genomic Sequences of Campylobacter coli Strains Isolated from Poultry Sold in Pennsylvania Farmers’ Markets
title_sort complete genomic sequences of campylobacter coli strains isolated from poultry sold in pennsylvania farmers’ markets
topic Genome Sequences
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7975865/
https://www.ncbi.nlm.nih.gov/pubmed/33737347
http://dx.doi.org/10.1128/MRA.00015-21
work_keys_str_mv AT gunthernereusw completegenomicsequencesofcampylobactercolistrainsisolatedfrompoultrysoldinpennsylvaniafarmersmarkets
AT kanrarsiddhartha completegenomicsequencesofcampylobactercolistrainsisolatedfrompoultrysoldinpennsylvaniafarmersmarkets
AT uhlichgaylen completegenomicsequencesofcampylobactercolistrainsisolatedfrompoultrysoldinpennsylvaniafarmersmarkets

Ejemplares similares