Cargando…
Four‐dimensional oral health‐related quality of life impact in children: A systematic review
Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7984176/ https://www.ncbi.nlm.nih.gov/pubmed/32757443 http://dx.doi.org/10.1111/joor.13066 |
_version_ | 1783668021152186368 |
---|---|
author | Omara, Maisa Stamm, Tanja Bekes, Katrin |
author_facet | Omara, Maisa Stamm, Tanja Bekes, Katrin |
author_sort | Omara, Maisa |
collection | PubMed |
description | Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed for adults; nevertheless, it is used off‐label for children as well. Our aim was to describe the OHRQoL impact on children measured by OHIP and map the information to the 4‐dimensions framework of OHRQoL. A systematic literature review following the PRISMA statement was conducted to include studies assessing OHRQoL of children ≤ 18 years using OHIP. The OHIP seven‐domain information was converted to the OHRQoL 4‐dimension scores accompanied by their means and 95% confidence interval. Risk of bias was assessed using a six‐item modified version of quality assessment tool for prevalence studies. We identified 647 articles, after abstracts screening, 111 articles were reviewed in full text. Twelve articles were included, and their information was mapped to the 4‐dimensional OHRQoL. Most included studies had low risk of bias. OHRQoL highest impact was observed for Oral Function, Orofacial Pain, and Orofacial Appearance for children with: Decayed‐Missing‐Filled‐Surface (DMFS) of ≥10, anterior tooth extraction without replacement and untreated fractured anterior teeth, respectively. Across all oral health conditions, Psychosocial Impact was less affected than the other three dimensions. OHIP has been applied to a considerable number of children and adolescents within the literature. One instrument and a standardised set of 4‐OHRQoL dimensions across the entire lifespan seem to be a promising measurement approach in dental and oral medicine. |
format | Online Article Text |
id | pubmed-7984176 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-79841762021-03-24 Four‐dimensional oral health‐related quality of life impact in children: A systematic review Omara, Maisa Stamm, Tanja Bekes, Katrin J Oral Rehabil Original Article Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed for adults; nevertheless, it is used off‐label for children as well. Our aim was to describe the OHRQoL impact on children measured by OHIP and map the information to the 4‐dimensions framework of OHRQoL. A systematic literature review following the PRISMA statement was conducted to include studies assessing OHRQoL of children ≤ 18 years using OHIP. The OHIP seven‐domain information was converted to the OHRQoL 4‐dimension scores accompanied by their means and 95% confidence interval. Risk of bias was assessed using a six‐item modified version of quality assessment tool for prevalence studies. We identified 647 articles, after abstracts screening, 111 articles were reviewed in full text. Twelve articles were included, and their information was mapped to the 4‐dimensional OHRQoL. Most included studies had low risk of bias. OHRQoL highest impact was observed for Oral Function, Orofacial Pain, and Orofacial Appearance for children with: Decayed‐Missing‐Filled‐Surface (DMFS) of ≥10, anterior tooth extraction without replacement and untreated fractured anterior teeth, respectively. Across all oral health conditions, Psychosocial Impact was less affected than the other three dimensions. OHIP has been applied to a considerable number of children and adolescents within the literature. One instrument and a standardised set of 4‐OHRQoL dimensions across the entire lifespan seem to be a promising measurement approach in dental and oral medicine. John Wiley and Sons Inc. 2020-08-19 2021-03 /pmc/articles/PMC7984176/ /pubmed/32757443 http://dx.doi.org/10.1111/joor.13066 Text en © 2020 The Authors. Journal of Oral Rehabilitation published by John Wiley & Sons Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Omara, Maisa Stamm, Tanja Bekes, Katrin Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title | Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title_full | Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title_fullStr | Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title_full_unstemmed | Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title_short | Four‐dimensional oral health‐related quality of life impact in children: A systematic review |
title_sort | four‐dimensional oral health‐related quality of life impact in children: a systematic review |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7984176/ https://www.ncbi.nlm.nih.gov/pubmed/32757443 http://dx.doi.org/10.1111/joor.13066 |
work_keys_str_mv | AT omaramaisa fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview AT stammtanja fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview AT bekeskatrin fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview |