Cargando…

Four‐dimensional oral health‐related quality of life impact in children: A systematic review

Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed...

Descripción completa

Detalles Bibliográficos
Autores principales: Omara, Maisa, Stamm, Tanja, Bekes, Katrin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7984176/
https://www.ncbi.nlm.nih.gov/pubmed/32757443
http://dx.doi.org/10.1111/joor.13066
_version_ 1783668021152186368
author Omara, Maisa
Stamm, Tanja
Bekes, Katrin
author_facet Omara, Maisa
Stamm, Tanja
Bekes, Katrin
author_sort Omara, Maisa
collection PubMed
description Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed for adults; nevertheless, it is used off‐label for children as well. Our aim was to describe the OHRQoL impact on children measured by OHIP and map the information to the 4‐dimensions framework of OHRQoL. A systematic literature review following the PRISMA statement was conducted to include studies assessing OHRQoL of children ≤ 18 years using OHIP. The OHIP seven‐domain information was converted to the OHRQoL 4‐dimension scores accompanied by their means and 95% confidence interval. Risk of bias was assessed using a six‐item modified version of quality assessment tool for prevalence studies. We identified 647 articles, after abstracts screening, 111 articles were reviewed in full text. Twelve articles were included, and their information was mapped to the 4‐dimensional OHRQoL. Most included studies had low risk of bias. OHRQoL highest impact was observed for Oral Function, Orofacial Pain, and Orofacial Appearance for children with: Decayed‐Missing‐Filled‐Surface (DMFS) of ≥10, anterior tooth extraction without replacement and untreated fractured anterior teeth, respectively. Across all oral health conditions, Psychosocial Impact was less affected than the other three dimensions. OHIP has been applied to a considerable number of children and adolescents within the literature. One instrument and a standardised set of 4‐OHRQoL dimensions across the entire lifespan seem to be a promising measurement approach in dental and oral medicine.
format Online
Article
Text
id pubmed-7984176
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-79841762021-03-24 Four‐dimensional oral health‐related quality of life impact in children: A systematic review Omara, Maisa Stamm, Tanja Bekes, Katrin J Oral Rehabil Original Article Oral health‐related quality of life (OHRQoL) is an important dental patient‐reported outcome which is commonly based on 4 dimensions, namely Oral Function, Orofacial Pain, Orofacial Appearance and Psychosocial Impact. The Oral Health Impact Profile (OHIP) is the most used OHRQoL instrument designed for adults; nevertheless, it is used off‐label for children as well. Our aim was to describe the OHRQoL impact on children measured by OHIP and map the information to the 4‐dimensions framework of OHRQoL. A systematic literature review following the PRISMA statement was conducted to include studies assessing OHRQoL of children ≤ 18 years using OHIP. The OHIP seven‐domain information was converted to the OHRQoL 4‐dimension scores accompanied by their means and 95% confidence interval. Risk of bias was assessed using a six‐item modified version of quality assessment tool for prevalence studies. We identified 647 articles, after abstracts screening, 111 articles were reviewed in full text. Twelve articles were included, and their information was mapped to the 4‐dimensional OHRQoL. Most included studies had low risk of bias. OHRQoL highest impact was observed for Oral Function, Orofacial Pain, and Orofacial Appearance for children with: Decayed‐Missing‐Filled‐Surface (DMFS) of ≥10, anterior tooth extraction without replacement and untreated fractured anterior teeth, respectively. Across all oral health conditions, Psychosocial Impact was less affected than the other three dimensions. OHIP has been applied to a considerable number of children and adolescents within the literature. One instrument and a standardised set of 4‐OHRQoL dimensions across the entire lifespan seem to be a promising measurement approach in dental and oral medicine. John Wiley and Sons Inc. 2020-08-19 2021-03 /pmc/articles/PMC7984176/ /pubmed/32757443 http://dx.doi.org/10.1111/joor.13066 Text en © 2020 The Authors. Journal of Oral Rehabilitation published by John Wiley & Sons Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Omara, Maisa
Stamm, Tanja
Bekes, Katrin
Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title_full Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title_fullStr Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title_full_unstemmed Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title_short Four‐dimensional oral health‐related quality of life impact in children: A systematic review
title_sort four‐dimensional oral health‐related quality of life impact in children: a systematic review
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7984176/
https://www.ncbi.nlm.nih.gov/pubmed/32757443
http://dx.doi.org/10.1111/joor.13066
work_keys_str_mv AT omaramaisa fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview
AT stammtanja fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview
AT bekeskatrin fourdimensionaloralhealthrelatedqualityoflifeimpactinchildrenasystematicreview