Cargando…
Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol
BACKGROUND: The care of the emergency department (ED) for a person after a suicide attempt can act as a protector against future suicidal behavior. For this reason, it is essential that the ED ensure an assistance that involves effective interventions in preventing suicidal behaviors. Among suicidal...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7992994/ https://www.ncbi.nlm.nih.gov/pubmed/33766137 http://dx.doi.org/10.1186/s13643-021-01609-5 |
_version_ | 1783669488056532992 |
---|---|
author | da Silva, Ana Paula Coutinho Henriques, Margarida Rangel Rothes, Inês Areal Zortea, Tiago Santos, José Carlos Cuijpers, Pim |
author_facet | da Silva, Ana Paula Coutinho Henriques, Margarida Rangel Rothes, Inês Areal Zortea, Tiago Santos, José Carlos Cuijpers, Pim |
author_sort | da Silva, Ana Paula Coutinho |
collection | PubMed |
description | BACKGROUND: The care of the emergency department (ED) for a person after a suicide attempt can act as a protector against future suicidal behavior. For this reason, it is essential that the ED ensure an assistance that involves effective interventions in preventing suicidal behaviors. Among suicidal behaviors, it is known that suicide attempt is one of the most lethal risk factors for consummated suicide. In addition, the risk for further attempts is greater in the period from the immediate post-discharge up to 12 months after the last attempt. This makes the ED a key link in the suicide prevention chain. The purpose of this review is to investigate the effects of psychosocial interventions on suicide prevention, when applied in the ED after a suicide attempt. METHODS: This systematic review protocol was built and registered with the collaboration of a multidisciplinary scientific team. The review will include randomized clinical studies, quasi-experimental trials, and comparative observational studies, all conducted with people (11 years old or more) who have received a psychosocial suicide prevention intervention initiated in the ED after a suicide attempt. The research will be conducted across databases such as Cochrane Library, PubMed, EMBASE, PsycINFO, and DARE. The repetition of a suicide attempt and death by suicide as primary outcomes will be analyzed. The eligibility of the studies and data extraction will be carried out by matched and blind researchers. The risk of bias will be addressed using appropriate instruments. The analyses and synthesis of the results will be both qualitative and quantitative. DISCUSSION: From a public health point of view, suicide is in itself a public health problem and requires appropriate interventions at different levels of care in order to be prevented. Taking into account that a high percentage of people who died by suicide sought the ED for suicide attempt in the year before their death, the ED is a clinical context with a privileged potential to implement these interventions. Presently, several clinical studies seek to validate interventions to be adopted regarding the prevention of suicidal behavior. Current evidence indicates that different interventions must be strategically combined to reduce suicide attempts and their mortality. SYSTEMATIC REVIEW REGISTRATION: PROSPERO registration number CRD42019131040 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01609-5. |
format | Online Article Text |
id | pubmed-7992994 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-79929942021-03-26 Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol da Silva, Ana Paula Coutinho Henriques, Margarida Rangel Rothes, Inês Areal Zortea, Tiago Santos, José Carlos Cuijpers, Pim Syst Rev Protocol BACKGROUND: The care of the emergency department (ED) for a person after a suicide attempt can act as a protector against future suicidal behavior. For this reason, it is essential that the ED ensure an assistance that involves effective interventions in preventing suicidal behaviors. Among suicidal behaviors, it is known that suicide attempt is one of the most lethal risk factors for consummated suicide. In addition, the risk for further attempts is greater in the period from the immediate post-discharge up to 12 months after the last attempt. This makes the ED a key link in the suicide prevention chain. The purpose of this review is to investigate the effects of psychosocial interventions on suicide prevention, when applied in the ED after a suicide attempt. METHODS: This systematic review protocol was built and registered with the collaboration of a multidisciplinary scientific team. The review will include randomized clinical studies, quasi-experimental trials, and comparative observational studies, all conducted with people (11 years old or more) who have received a psychosocial suicide prevention intervention initiated in the ED after a suicide attempt. The research will be conducted across databases such as Cochrane Library, PubMed, EMBASE, PsycINFO, and DARE. The repetition of a suicide attempt and death by suicide as primary outcomes will be analyzed. The eligibility of the studies and data extraction will be carried out by matched and blind researchers. The risk of bias will be addressed using appropriate instruments. The analyses and synthesis of the results will be both qualitative and quantitative. DISCUSSION: From a public health point of view, suicide is in itself a public health problem and requires appropriate interventions at different levels of care in order to be prevented. Taking into account that a high percentage of people who died by suicide sought the ED for suicide attempt in the year before their death, the ED is a clinical context with a privileged potential to implement these interventions. Presently, several clinical studies seek to validate interventions to be adopted regarding the prevention of suicidal behavior. Current evidence indicates that different interventions must be strategically combined to reduce suicide attempts and their mortality. SYSTEMATIC REVIEW REGISTRATION: PROSPERO registration number CRD42019131040 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01609-5. BioMed Central 2021-03-05 /pmc/articles/PMC7992994/ /pubmed/33766137 http://dx.doi.org/10.1186/s13643-021-01609-5 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol da Silva, Ana Paula Coutinho Henriques, Margarida Rangel Rothes, Inês Areal Zortea, Tiago Santos, José Carlos Cuijpers, Pim Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title | Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title_full | Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title_fullStr | Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title_full_unstemmed | Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title_short | Effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
title_sort | effects of psychosocial interventions among people cared for in emergency departments after a suicide attempt: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7992994/ https://www.ncbi.nlm.nih.gov/pubmed/33766137 http://dx.doi.org/10.1186/s13643-021-01609-5 |
work_keys_str_mv | AT dasilvaanapaulacoutinho effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol AT henriquesmargaridarangel effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol AT rothesinesareal effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol AT zorteatiago effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol AT santosjosecarlos effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol AT cuijperspim effectsofpsychosocialinterventionsamongpeoplecaredforinemergencydepartmentsafterasuicideattemptasystematicreviewprotocol |