Cargando…
The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7995849/ https://www.ncbi.nlm.nih.gov/pubmed/33796779 http://dx.doi.org/10.1080/23802359.2021.1902409 |
_version_ | 1783669993631645696 |
---|---|
author | García-Mir, Lluís Ojeda, Darío I. Fuertes-Aguilar, Javier |
author_facet | García-Mir, Lluís Ojeda, Darío I. Fuertes-Aguilar, Javier |
author_sort | García-Mir, Lluís |
collection | PubMed |
description | The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860 bp and a small single-copy region of 20,970 bp. The sea mallow chloroplast genome has 131 known genes, including 85 protein-coding genes, eight ribosomal RNA genes, and 37 tRNA genes. The phylogenomic analysis showed that M. wigandii forms a cluster with Althaea officinalis with a strong bootstrap support and is sister to sequences belonging to the tribe Gossypieae. All of them are grouped in a lineage with other members of the subfamily Malvoideae. This newly sequenced chloroplast genome sequence provides useful genetic information to explore the origin and evolution of the Mediterranean radiation that gave rise to the generic alliance of Malva. |
format | Online Article Text |
id | pubmed-7995849 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-79958492021-03-31 The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) García-Mir, Lluís Ojeda, Darío I. Fuertes-Aguilar, Javier Mitochondrial DNA B Resour Mitogenome Announcement The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860 bp and a small single-copy region of 20,970 bp. The sea mallow chloroplast genome has 131 known genes, including 85 protein-coding genes, eight ribosomal RNA genes, and 37 tRNA genes. The phylogenomic analysis showed that M. wigandii forms a cluster with Althaea officinalis with a strong bootstrap support and is sister to sequences belonging to the tribe Gossypieae. All of them are grouped in a lineage with other members of the subfamily Malvoideae. This newly sequenced chloroplast genome sequence provides useful genetic information to explore the origin and evolution of the Mediterranean radiation that gave rise to the generic alliance of Malva. Taylor & Francis 2021-03-24 /pmc/articles/PMC7995849/ /pubmed/33796779 http://dx.doi.org/10.1080/23802359.2021.1902409 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement García-Mir, Lluís Ojeda, Darío I. Fuertes-Aguilar, Javier The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title | The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title_full | The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title_fullStr | The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title_full_unstemmed | The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title_short | The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) |
title_sort | complete chloroplast genome of malva wigandii (alef.) m.f. ray (malvaceae, malvoideae) |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7995849/ https://www.ncbi.nlm.nih.gov/pubmed/33796779 http://dx.doi.org/10.1080/23802359.2021.1902409 |
work_keys_str_mv | AT garciamirlluis thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae AT ojedadarioi thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae AT fuertesaguilarjavier thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae AT garciamirlluis completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae AT ojedadarioi completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae AT fuertesaguilarjavier completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae |