Cargando…

The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)

The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860...

Descripción completa

Detalles Bibliográficos
Autores principales: García-Mir, Lluís, Ojeda, Darío I., Fuertes-Aguilar, Javier
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7995849/
https://www.ncbi.nlm.nih.gov/pubmed/33796779
http://dx.doi.org/10.1080/23802359.2021.1902409
_version_ 1783669993631645696
author García-Mir, Lluís
Ojeda, Darío I.
Fuertes-Aguilar, Javier
author_facet García-Mir, Lluís
Ojeda, Darío I.
Fuertes-Aguilar, Javier
author_sort García-Mir, Lluís
collection PubMed
description The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860 bp and a small single-copy region of 20,970 bp. The sea mallow chloroplast genome has 131 known genes, including 85 protein-coding genes, eight ribosomal RNA genes, and 37 tRNA genes. The phylogenomic analysis showed that M. wigandii forms a cluster with Althaea officinalis with a strong bootstrap support and is sister to sequences belonging to the tribe Gossypieae. All of them are grouped in a lineage with other members of the subfamily Malvoideae. This newly sequenced chloroplast genome sequence provides useful genetic information to explore the origin and evolution of the Mediterranean radiation that gave rise to the generic alliance of Malva.
format Online
Article
Text
id pubmed-7995849
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-79958492021-03-31 The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae) García-Mir, Lluís Ojeda, Darío I. Fuertes-Aguilar, Javier Mitochondrial DNA B Resour Mitogenome Announcement The complete chloroplast genome sequence of wild sea mallow Malva wigandii (=Lavatera maritima) was determined and characterized in this study. The genome is 158,162 bp long, containing a pair of inverted repeats regions (IRs) of 25,166 bp, which are separated by a large single-copy region of 86,860 bp and a small single-copy region of 20,970 bp. The sea mallow chloroplast genome has 131 known genes, including 85 protein-coding genes, eight ribosomal RNA genes, and 37 tRNA genes. The phylogenomic analysis showed that M. wigandii forms a cluster with Althaea officinalis with a strong bootstrap support and is sister to sequences belonging to the tribe Gossypieae. All of them are grouped in a lineage with other members of the subfamily Malvoideae. This newly sequenced chloroplast genome sequence provides useful genetic information to explore the origin and evolution of the Mediterranean radiation that gave rise to the generic alliance of Malva. Taylor & Francis 2021-03-24 /pmc/articles/PMC7995849/ /pubmed/33796779 http://dx.doi.org/10.1080/23802359.2021.1902409 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
García-Mir, Lluís
Ojeda, Darío I.
Fuertes-Aguilar, Javier
The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title_full The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title_fullStr The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title_full_unstemmed The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title_short The complete chloroplast genome of Malva wigandii (Alef.) M.F. Ray (Malvaceae, Malvoideae)
title_sort complete chloroplast genome of malva wigandii (alef.) m.f. ray (malvaceae, malvoideae)
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7995849/
https://www.ncbi.nlm.nih.gov/pubmed/33796779
http://dx.doi.org/10.1080/23802359.2021.1902409
work_keys_str_mv AT garciamirlluis thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae
AT ojedadarioi thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae
AT fuertesaguilarjavier thecompletechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae
AT garciamirlluis completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae
AT ojedadarioi completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae
AT fuertesaguilarjavier completechloroplastgenomeofmalvawigandiialefmfraymalvaceaemalvoideae