Cargando…
Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections
This study aimed to characterize carbapenem-resistant Klebsiella pneumoniae (CR-KP) co-harboring bla (KPC-2)-carrying plasmid and pLVPK-like virulence plasmid. Between December 2017 and April 2018, 24 CR-KP isolates were recovered from 24 patients with bacteremia. The mortality was 66.7%. Pulsed-fie...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7996060/ https://www.ncbi.nlm.nih.gov/pubmed/33777826 http://dx.doi.org/10.3389/fcimb.2020.556654 |
_version_ | 1783670035650183168 |
---|---|
author | Du, Fang-ling Huang, Qi-sen Wei, Dan-dan Mei, Yan-fang Long, Dan Liao, Wen-jian Wan, La-gen Liu, Yang Zhang, Wei |
author_facet | Du, Fang-ling Huang, Qi-sen Wei, Dan-dan Mei, Yan-fang Long, Dan Liao, Wen-jian Wan, La-gen Liu, Yang Zhang, Wei |
author_sort | Du, Fang-ling |
collection | PubMed |
description | This study aimed to characterize carbapenem-resistant Klebsiella pneumoniae (CR-KP) co-harboring bla (KPC-2)-carrying plasmid and pLVPK-like virulence plasmid. Between December 2017 and April 2018, 24 CR-KP isolates were recovered from 24 patients with bacteremia. The mortality was 66.7%. Pulsed-field gel electrophoresis and multilocus sequence typing results indicated four clusters, of which cluster A (n = 21, 87.5%) belonged to ST11 and the three remaining isolates (ST412, ST65, ST23) had different pulsotypes (cluster B, C, D). The bla (KPC-2)-carrying plasmids all belonged to IncFII(K) type, and the size ranged from 100 to 390 kb. Nineteen strains (79.2%) had a 219-kb virulence plasmid possessed high similarity to pLVPK from CG43 with serotype K2. Two strains had a 224-kb virulence plasmid resembled plasmid pK2044 from K. pneumoniae NTUH-K2044(ST23). Moreover, three strains carried three different hybrid resistance- and virulence-encoding plasmids. Conjugation assays showed that both bla (KPC-2) and rmpA2 genes could be successfully transferred to E. coli J53 in 62.5% of the strains at frequencies of 4.5 × 10(−6) to 2.4 × 10(−4), of which three co-transferred bla (KPC-2) along with rmpA2 in large plasmids. Infection assays in the Galleria mellonella model demonstrated the virulence level of these isolates was found to be consistently higher than that of classic Klebsiella pneumoniae. In conclusion, CR-KP co-harboring bla (KPC-2)-carrying plasmid and pLVPK-like virulence plasmid were characterized by multi-drug resistance, enhanced virulence, and transferability, and should, therefore, be regarded as a real superbug that could pose a serious threat to public health. Hence, heightened efforts are urgently needed to avoid its co-transmission of the virulent plasmid (gene) and resistant plasmid (gene) in clinical isolates. |
format | Online Article Text |
id | pubmed-7996060 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-79960602021-03-27 Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections Du, Fang-ling Huang, Qi-sen Wei, Dan-dan Mei, Yan-fang Long, Dan Liao, Wen-jian Wan, La-gen Liu, Yang Zhang, Wei Front Cell Infect Microbiol Cellular and Infection Microbiology This study aimed to characterize carbapenem-resistant Klebsiella pneumoniae (CR-KP) co-harboring bla (KPC-2)-carrying plasmid and pLVPK-like virulence plasmid. Between December 2017 and April 2018, 24 CR-KP isolates were recovered from 24 patients with bacteremia. The mortality was 66.7%. Pulsed-field gel electrophoresis and multilocus sequence typing results indicated four clusters, of which cluster A (n = 21, 87.5%) belonged to ST11 and the three remaining isolates (ST412, ST65, ST23) had different pulsotypes (cluster B, C, D). The bla (KPC-2)-carrying plasmids all belonged to IncFII(K) type, and the size ranged from 100 to 390 kb. Nineteen strains (79.2%) had a 219-kb virulence plasmid possessed high similarity to pLVPK from CG43 with serotype K2. Two strains had a 224-kb virulence plasmid resembled plasmid pK2044 from K. pneumoniae NTUH-K2044(ST23). Moreover, three strains carried three different hybrid resistance- and virulence-encoding plasmids. Conjugation assays showed that both bla (KPC-2) and rmpA2 genes could be successfully transferred to E. coli J53 in 62.5% of the strains at frequencies of 4.5 × 10(−6) to 2.4 × 10(−4), of which three co-transferred bla (KPC-2) along with rmpA2 in large plasmids. Infection assays in the Galleria mellonella model demonstrated the virulence level of these isolates was found to be consistently higher than that of classic Klebsiella pneumoniae. In conclusion, CR-KP co-harboring bla (KPC-2)-carrying plasmid and pLVPK-like virulence plasmid were characterized by multi-drug resistance, enhanced virulence, and transferability, and should, therefore, be regarded as a real superbug that could pose a serious threat to public health. Hence, heightened efforts are urgently needed to avoid its co-transmission of the virulent plasmid (gene) and resistant plasmid (gene) in clinical isolates. Frontiers Media S.A. 2021-03-12 /pmc/articles/PMC7996060/ /pubmed/33777826 http://dx.doi.org/10.3389/fcimb.2020.556654 Text en Copyright © 2021 Du, Huang, Wei, Mei, Long, Liao, Wan, Liu and Zhang http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Cellular and Infection Microbiology Du, Fang-ling Huang, Qi-sen Wei, Dan-dan Mei, Yan-fang Long, Dan Liao, Wen-jian Wan, La-gen Liu, Yang Zhang, Wei Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title | Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title_full | Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title_fullStr | Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title_full_unstemmed | Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title_short | Prevalence of Carbapenem-Resistant Klebsiella pneumoniae Co-Harboring blaKPC-Carrying Plasmid and pLVPK-Like Virulence Plasmid in Bloodstream Infections |
title_sort | prevalence of carbapenem-resistant klebsiella pneumoniae co-harboring blakpc-carrying plasmid and plvpk-like virulence plasmid in bloodstream infections |
topic | Cellular and Infection Microbiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7996060/ https://www.ncbi.nlm.nih.gov/pubmed/33777826 http://dx.doi.org/10.3389/fcimb.2020.556654 |
work_keys_str_mv | AT dufangling prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT huangqisen prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT weidandan prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT meiyanfang prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT longdan prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT liaowenjian prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT wanlagen prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT liuyang prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections AT zhangwei prevalenceofcarbapenemresistantklebsiellapneumoniaecoharboringblakpccarryingplasmidandplvpklikevirulenceplasmidinbloodstreaminfections |