Cargando…

Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review

Elevated inflammation in pregnancy has been associated with multiple adverse pregnancy outcomes and potentially an increased susceptibility to future chronic disease. How maternal dietary patterns influence systemic inflammation during pregnancy requires further investigation. The purpose of this re...

Descripción completa

Detalles Bibliográficos
Autores principales: Yeh, Kuan-Lin, Kautz, Amber, Lohse, Barbara, Groth, Susan W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8000934/
https://www.ncbi.nlm.nih.gov/pubmed/33806342
http://dx.doi.org/10.3390/nu13030834
_version_ 1783671112338505728
author Yeh, Kuan-Lin
Kautz, Amber
Lohse, Barbara
Groth, Susan W.
author_facet Yeh, Kuan-Lin
Kautz, Amber
Lohse, Barbara
Groth, Susan W.
author_sort Yeh, Kuan-Lin
collection PubMed
description Elevated inflammation in pregnancy has been associated with multiple adverse pregnancy outcomes and potentially an increased susceptibility to future chronic disease. How maternal dietary patterns influence systemic inflammation during pregnancy requires further investigation. The purpose of this review was to comprehensively evaluate studies that assessed dietary patterns and inflammatory markers during pregnancy. This review was guided by the Preferred Reporting Items for Systematic Review and Meta-Analyses. Included studies were sourced from EMBASE, PubMed, Web of Science, and Scopus and evaluated using The Quality Assessment Tool for Quantitative Studies. Inclusion criteria consisted of human studies published in English between January 2007 and May 2020 that addressed associations between dietary patterns and inflammatory markers during pregnancy. Studies focused on a single nutrient, supplementation, or combined interventions were excluded. A total of 17 studies were included. Despite some inconsistent findings, maternal diets characterized by a higher intake of animal protein and cholesterol and/or a lower intake of fiber were shown to be associated with certain pro-inflammatory markers (C-reactive protein (CRP), interleukin-6 (IL-6), tumor necrosis factor-α (TNF- α), IL-8, serum amyloid A (SAA), and glycoprotein acetylation (GlycA)). Future studies that explore a broader range of inflammatory markers in the pregnant population, reduce measurement errors, and ensure adequate statistical adjustment are warranted.
format Online
Article
Text
id pubmed-8000934
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-80009342021-03-28 Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review Yeh, Kuan-Lin Kautz, Amber Lohse, Barbara Groth, Susan W. Nutrients Review Elevated inflammation in pregnancy has been associated with multiple adverse pregnancy outcomes and potentially an increased susceptibility to future chronic disease. How maternal dietary patterns influence systemic inflammation during pregnancy requires further investigation. The purpose of this review was to comprehensively evaluate studies that assessed dietary patterns and inflammatory markers during pregnancy. This review was guided by the Preferred Reporting Items for Systematic Review and Meta-Analyses. Included studies were sourced from EMBASE, PubMed, Web of Science, and Scopus and evaluated using The Quality Assessment Tool for Quantitative Studies. Inclusion criteria consisted of human studies published in English between January 2007 and May 2020 that addressed associations between dietary patterns and inflammatory markers during pregnancy. Studies focused on a single nutrient, supplementation, or combined interventions were excluded. A total of 17 studies were included. Despite some inconsistent findings, maternal diets characterized by a higher intake of animal protein and cholesterol and/or a lower intake of fiber were shown to be associated with certain pro-inflammatory markers (C-reactive protein (CRP), interleukin-6 (IL-6), tumor necrosis factor-α (TNF- α), IL-8, serum amyloid A (SAA), and glycoprotein acetylation (GlycA)). Future studies that explore a broader range of inflammatory markers in the pregnant population, reduce measurement errors, and ensure adequate statistical adjustment are warranted. MDPI 2021-03-04 /pmc/articles/PMC8000934/ /pubmed/33806342 http://dx.doi.org/10.3390/nu13030834 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ).
spellingShingle Review
Yeh, Kuan-Lin
Kautz, Amber
Lohse, Barbara
Groth, Susan W.
Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title_full Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title_fullStr Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title_full_unstemmed Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title_short Associations between Dietary Patterns and Inflammatory Markers during Pregnancy: A Systematic Review
title_sort associations between dietary patterns and inflammatory markers during pregnancy: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8000934/
https://www.ncbi.nlm.nih.gov/pubmed/33806342
http://dx.doi.org/10.3390/nu13030834
work_keys_str_mv AT yehkuanlin associationsbetweendietarypatternsandinflammatorymarkersduringpregnancyasystematicreview
AT kautzamber associationsbetweendietarypatternsandinflammatorymarkersduringpregnancyasystematicreview
AT lohsebarbara associationsbetweendietarypatternsandinflammatorymarkersduringpregnancyasystematicreview
AT grothsusanw associationsbetweendietarypatternsandinflammatorymarkersduringpregnancyasystematicreview