A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases

BACKGROUND: Primary signet-ring cell carcinoma of the uterine cervix (PSRCCC) is defined as a mucinous carcinoma. PSRCCC with independent bilateral ovarian metastases has not been previously reported in the literature. CASE PRESENTATION: Herein we describe a case of PSRCCC with ovarian involvement....

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Shiyun, Gan, Fuqiang, Luo, Manling, Luo, Puying
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Dove 2021
Materias:
Case Report
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8001646/
https://www.ncbi.nlm.nih.gov/pubmed/33790573
http://dx.doi.org/10.2147/OTT.S300424
_version_ 1783671278974009344
author Li, Shiyun
Gan, Fuqiang
Luo, Manling
Luo, Puying
author_facet Li, Shiyun
Gan, Fuqiang
Luo, Manling
Luo, Puying
author_sort Li, Shiyun
collection PubMed
description BACKGROUND: Primary signet-ring cell carcinoma of the uterine cervix (PSRCCC) is defined as a mucinous carcinoma. PSRCCC with independent bilateral ovarian metastases has not been previously reported in the literature. CASE PRESENTATION: Herein we describe a case of PSRCCC with ovarian involvement. The patient underwent a detailed complete physical examination, and surgery was then performed to resect all of the tumors. All tumors expressed human papillomavirus 18 no distant tumors were detected, and estrogen receptor and progesterone receptor testing were negative, suggesting that the cervix was the primary site. CONCLUSION: This is the first report of a case of PSRCCC metastasis to bilateral ovaries only. Conservative management of human papillomavirus-associated type endocervical adenocarcinomas with independent ovarian metastases should be considered.
format Online
Article
Text
id pubmed-8001646
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Dove
record_format MEDLINE/PubMed
spelling pubmed-80016462021-03-30 A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases Li, Shiyun Gan, Fuqiang Luo, Manling Luo, Puying Onco Targets Ther Case Report BACKGROUND: Primary signet-ring cell carcinoma of the uterine cervix (PSRCCC) is defined as a mucinous carcinoma. PSRCCC with independent bilateral ovarian metastases has not been previously reported in the literature. CASE PRESENTATION: Herein we describe a case of PSRCCC with ovarian involvement. The patient underwent a detailed complete physical examination, and surgery was then performed to resect all of the tumors. All tumors expressed human papillomavirus 18 no distant tumors were detected, and estrogen receptor and progesterone receptor testing were negative, suggesting that the cervix was the primary site. CONCLUSION: This is the first report of a case of PSRCCC metastasis to bilateral ovaries only. Conservative management of human papillomavirus-associated type endocervical adenocarcinomas with independent ovarian metastases should be considered. Dove 2021-03-23 /pmc/articles/PMC8001646/ /pubmed/33790573 http://dx.doi.org/10.2147/OTT.S300424 Text en © 2021 Li et al. http://creativecommons.org/licenses/by-nc/3.0/ This work is published and licensed by Dove Medical Press Limited. The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed. For permission for commercial use of this work, please see paragraphs 4.2 and 5 of our Terms (https://www.dovepress.com/terms.php).
spellingShingle Case Report
Li, Shiyun
Gan, Fuqiang
Luo, Manling
Luo, Puying
A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title_full A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title_fullStr A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title_full_unstemmed A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title_short A Rare Case of Primary Signet-Ring Cell Cervical Carcinoma: Early Stage with Independent Bilateral Ovarian Metastases
title_sort rare case of primary signet-ring cell cervical carcinoma: early stage with independent bilateral ovarian metastases
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8001646/
https://www.ncbi.nlm.nih.gov/pubmed/33790573
http://dx.doi.org/10.2147/OTT.S300424
work_keys_str_mv AT lishiyun ararecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT ganfuqiang ararecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT luomanling ararecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT luopuying ararecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT lishiyun rarecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT ganfuqiang rarecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT luomanling rarecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases
AT luopuying rarecaseofprimarysignetringcellcervicalcarcinomaearlystagewithindependentbilateralovarianmetastases

Ejemplares similares