Cargando…
Frailty inclusive care in acute and community-based settings: a systematic review protocol
BACKGROUND: Frailty is a known risk factor for an array of adverse outcomes including more frequent and prolonged health services use and high health care costs. Aging of the population has implications for care provision across the care continuum, particularly for people living with frailty. Despit...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8004471/ https://www.ncbi.nlm.nih.gov/pubmed/33771224 http://dx.doi.org/10.1186/s13643-021-01638-0 |
_version_ | 1783671915745902592 |
---|---|
author | Montgomery, Carmel L. Hopkin, Gareth Bagshaw, Sean M. Hessey, Erin Rolfson, Darryl B. |
author_facet | Montgomery, Carmel L. Hopkin, Gareth Bagshaw, Sean M. Hessey, Erin Rolfson, Darryl B. |
author_sort | Montgomery, Carmel L. |
collection | PubMed |
description | BACKGROUND: Frailty is a known risk factor for an array of adverse outcomes including more frequent and prolonged health services use and high health care costs. Aging of the population has implications for care provision across the care continuum, particularly for people living with frailty. Despite known risks associated with frailty, there has been limited research on care pathways that address the needs of persons living with frailty. Our study aims to review and examine, in a rigorous way, the quality of evidence for multi-component interventions and care pathways focused on frailty. METHODS: A comprehensive electronic search strategy will be used to identify studies that evaluate multi-component interventions or care pathways for persons living with frailty. The search strategy will include terms for frailty, multi-component interventions, effectiveness, and cost effectiveness applied to the following databases: MEDLINE (OVID), EMBASE (OVID), CINAHL (EBSCO), Cochrane Central Register of Controlled Trials (CENTRAL), and Cochrane Database of Systematic Reviews. An adapted search for Google Scholar and gray literature databases will also be used. References of included studies will be hand-searched for additional citations of frailty-inclusive care. Known experts and corresponding authors of identified articles will be contacted by email to identify further eligible studies. Risk of bias will be assessed using the Effective Public Health Practice Project Quality Assessment tool. Data will be extracted from eligible studies and it is anticipated that narrative analysis will be used. If studies with sufficient homogeneity are found, then pooled effects will be reported using meta-analysis. DISCUSSION: This review will appraise the evidence currently available on multi-component frailty interventions. Results will inform on clinical pathway development for people living with frailty across the care continuum and will guide future research to address gaps in the literature and areas in need of further development. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42020166733 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01638-0. |
format | Online Article Text |
id | pubmed-8004471 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-80044712021-03-30 Frailty inclusive care in acute and community-based settings: a systematic review protocol Montgomery, Carmel L. Hopkin, Gareth Bagshaw, Sean M. Hessey, Erin Rolfson, Darryl B. Syst Rev Protocol BACKGROUND: Frailty is a known risk factor for an array of adverse outcomes including more frequent and prolonged health services use and high health care costs. Aging of the population has implications for care provision across the care continuum, particularly for people living with frailty. Despite known risks associated with frailty, there has been limited research on care pathways that address the needs of persons living with frailty. Our study aims to review and examine, in a rigorous way, the quality of evidence for multi-component interventions and care pathways focused on frailty. METHODS: A comprehensive electronic search strategy will be used to identify studies that evaluate multi-component interventions or care pathways for persons living with frailty. The search strategy will include terms for frailty, multi-component interventions, effectiveness, and cost effectiveness applied to the following databases: MEDLINE (OVID), EMBASE (OVID), CINAHL (EBSCO), Cochrane Central Register of Controlled Trials (CENTRAL), and Cochrane Database of Systematic Reviews. An adapted search for Google Scholar and gray literature databases will also be used. References of included studies will be hand-searched for additional citations of frailty-inclusive care. Known experts and corresponding authors of identified articles will be contacted by email to identify further eligible studies. Risk of bias will be assessed using the Effective Public Health Practice Project Quality Assessment tool. Data will be extracted from eligible studies and it is anticipated that narrative analysis will be used. If studies with sufficient homogeneity are found, then pooled effects will be reported using meta-analysis. DISCUSSION: This review will appraise the evidence currently available on multi-component frailty interventions. Results will inform on clinical pathway development for people living with frailty across the care continuum and will guide future research to address gaps in the literature and areas in need of further development. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42020166733 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01638-0. BioMed Central 2021-03-26 /pmc/articles/PMC8004471/ /pubmed/33771224 http://dx.doi.org/10.1186/s13643-021-01638-0 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Montgomery, Carmel L. Hopkin, Gareth Bagshaw, Sean M. Hessey, Erin Rolfson, Darryl B. Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title | Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title_full | Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title_fullStr | Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title_full_unstemmed | Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title_short | Frailty inclusive care in acute and community-based settings: a systematic review protocol |
title_sort | frailty inclusive care in acute and community-based settings: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8004471/ https://www.ncbi.nlm.nih.gov/pubmed/33771224 http://dx.doi.org/10.1186/s13643-021-01638-0 |
work_keys_str_mv | AT montgomerycarmell frailtyinclusivecareinacuteandcommunitybasedsettingsasystematicreviewprotocol AT hopkingareth frailtyinclusivecareinacuteandcommunitybasedsettingsasystematicreviewprotocol AT bagshawseanm frailtyinclusivecareinacuteandcommunitybasedsettingsasystematicreviewprotocol AT hesseyerin frailtyinclusivecareinacuteandcommunitybasedsettingsasystematicreviewprotocol AT rolfsondarrylb frailtyinclusivecareinacuteandcommunitybasedsettingsasystematicreviewprotocol |