Cargando…

The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages

African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency...

Descripción completa

Detalles Bibliográficos
Autores principales: Oh, Taehwan, Do, Duy Tien, Vo, Hung Van, Kwon, Hyeok-il, Lee, Seung-Chul, Kim, Min Ho, Nguyen, Dung Thi Thu, Le, Quang Tin Vinh, Tran, Tan Minh, Nguyen, Toan Tat, Lee, Joo Young, Chae, Chanhee
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017199/
https://www.ncbi.nlm.nih.gov/pubmed/33816588
http://dx.doi.org/10.3389/fvets.2021.645456
_version_ 1783674012812967936
author Oh, Taehwan
Do, Duy Tien
Vo, Hung Van
Kwon, Hyeok-il
Lee, Seung-Chul
Kim, Min Ho
Nguyen, Dung Thi Thu
Le, Quang Tin Vinh
Tran, Tan Minh
Nguyen, Toan Tat
Lee, Joo Young
Chae, Chanhee
author_facet Oh, Taehwan
Do, Duy Tien
Vo, Hung Van
Kwon, Hyeok-il
Lee, Seung-Chul
Kim, Min Ho
Nguyen, Dung Thi Thu
Le, Quang Tin Vinh
Tran, Tan Minh
Nguyen, Toan Tat
Lee, Joo Young
Chae, Chanhee
author_sort Oh, Taehwan
collection PubMed
description African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production.
format Online
Article
Text
id pubmed-8017199
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-80171992021-04-03 The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages Oh, Taehwan Do, Duy Tien Vo, Hung Van Kwon, Hyeok-il Lee, Seung-Chul Kim, Min Ho Nguyen, Dung Thi Thu Le, Quang Tin Vinh Tran, Tan Minh Nguyen, Toan Tat Lee, Joo Young Chae, Chanhee Front Vet Sci Veterinary Science African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production. Frontiers Media S.A. 2021-03-19 /pmc/articles/PMC8017199/ /pubmed/33816588 http://dx.doi.org/10.3389/fvets.2021.645456 Text en Copyright © 2021 Oh, Do, Vo, Kwon, Lee, Kim, Nguyen, Le, Tran, Nguyen, Lee and Chae. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Veterinary Science
Oh, Taehwan
Do, Duy Tien
Vo, Hung Van
Kwon, Hyeok-il
Lee, Seung-Chul
Kim, Min Ho
Nguyen, Dung Thi Thu
Le, Quang Tin Vinh
Tran, Tan Minh
Nguyen, Toan Tat
Lee, Joo Young
Chae, Chanhee
The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_full The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_fullStr The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_full_unstemmed The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_short The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_sort isolation and replication of african swine fever virus in primary renal-derived swine macrophages
topic Veterinary Science
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017199/
https://www.ncbi.nlm.nih.gov/pubmed/33816588
http://dx.doi.org/10.3389/fvets.2021.645456
work_keys_str_mv AT ohtaehwan theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT doduytien theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT vohungvan theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT kwonhyeokil theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT leeseungchul theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT kimminho theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT nguyendungthithu theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT lequangtinvinh theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT trantanminh theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT nguyentoantat theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT leejooyoung theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT chaechanhee theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT ohtaehwan isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT doduytien isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT vohungvan isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT kwonhyeokil isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT leeseungchul isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT kimminho isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT nguyendungthithu isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT lequangtinvinh isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT trantanminh isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT nguyentoantat isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT leejooyoung isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT chaechanhee isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages