Cargando…
The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017199/ https://www.ncbi.nlm.nih.gov/pubmed/33816588 http://dx.doi.org/10.3389/fvets.2021.645456 |
_version_ | 1783674012812967936 |
---|---|
author | Oh, Taehwan Do, Duy Tien Vo, Hung Van Kwon, Hyeok-il Lee, Seung-Chul Kim, Min Ho Nguyen, Dung Thi Thu Le, Quang Tin Vinh Tran, Tan Minh Nguyen, Toan Tat Lee, Joo Young Chae, Chanhee |
author_facet | Oh, Taehwan Do, Duy Tien Vo, Hung Van Kwon, Hyeok-il Lee, Seung-Chul Kim, Min Ho Nguyen, Dung Thi Thu Le, Quang Tin Vinh Tran, Tan Minh Nguyen, Toan Tat Lee, Joo Young Chae, Chanhee |
author_sort | Oh, Taehwan |
collection | PubMed |
description | African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production. |
format | Online Article Text |
id | pubmed-8017199 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-80171992021-04-03 The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages Oh, Taehwan Do, Duy Tien Vo, Hung Van Kwon, Hyeok-il Lee, Seung-Chul Kim, Min Ho Nguyen, Dung Thi Thu Le, Quang Tin Vinh Tran, Tan Minh Nguyen, Toan Tat Lee, Joo Young Chae, Chanhee Front Vet Sci Veterinary Science African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production. Frontiers Media S.A. 2021-03-19 /pmc/articles/PMC8017199/ /pubmed/33816588 http://dx.doi.org/10.3389/fvets.2021.645456 Text en Copyright © 2021 Oh, Do, Vo, Kwon, Lee, Kim, Nguyen, Le, Tran, Nguyen, Lee and Chae. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Veterinary Science Oh, Taehwan Do, Duy Tien Vo, Hung Van Kwon, Hyeok-il Lee, Seung-Chul Kim, Min Ho Nguyen, Dung Thi Thu Le, Quang Tin Vinh Tran, Tan Minh Nguyen, Toan Tat Lee, Joo Young Chae, Chanhee The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title | The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title_full | The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title_fullStr | The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title_full_unstemmed | The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title_short | The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages |
title_sort | isolation and replication of african swine fever virus in primary renal-derived swine macrophages |
topic | Veterinary Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017199/ https://www.ncbi.nlm.nih.gov/pubmed/33816588 http://dx.doi.org/10.3389/fvets.2021.645456 |
work_keys_str_mv | AT ohtaehwan theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT doduytien theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT vohungvan theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT kwonhyeokil theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT leeseungchul theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT kimminho theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT nguyendungthithu theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT lequangtinvinh theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT trantanminh theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT nguyentoantat theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT leejooyoung theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT chaechanhee theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT ohtaehwan isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT doduytien isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT vohungvan isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT kwonhyeokil isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT leeseungchul isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT kimminho isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT nguyendungthithu isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT lequangtinvinh isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT trantanminh isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT nguyentoantat isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT leejooyoung isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages AT chaechanhee isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages |