Cargando…
“… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study ai...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017655/ https://www.ncbi.nlm.nih.gov/pubmed/33794871 http://dx.doi.org/10.1186/s12913-021-06282-x |
_version_ | 1783674092938854400 |
---|---|
author | Schwandt, Hilary M. Boulware, Angel Corey, Julia Herrera, Ana Hudler, Ethan Imbabazi, Claudette King, Ilia Linus, Jessica Manzi, Innocent Merritt, Madelyn Mezier, Lyn Miller, Abigail Morris, Haley Musemakweli, Dieudonne Musekura, Uwase Mutuyimana, Divine Ntakarutimana, Chimene Patel, Nirali Scanteianu, Adriana Shemeza, Biganette-Evidente Sterling-Donaldson, Giànna Umutoni, Chantal Uwera, Lyse Zeiler, Madeleine Feinberg, Seth |
author_facet | Schwandt, Hilary M. Boulware, Angel Corey, Julia Herrera, Ana Hudler, Ethan Imbabazi, Claudette King, Ilia Linus, Jessica Manzi, Innocent Merritt, Madelyn Mezier, Lyn Miller, Abigail Morris, Haley Musemakweli, Dieudonne Musekura, Uwase Mutuyimana, Divine Ntakarutimana, Chimene Patel, Nirali Scanteianu, Adriana Shemeza, Biganette-Evidente Sterling-Donaldson, Giànna Umutoni, Chantal Uwera, Lyse Zeiler, Madeleine Feinberg, Seth |
author_sort | Schwandt, Hilary M. |
collection | PubMed |
description | BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study aims to understand the client-provider relationship in the Rwandan family planning program and to also examine barriers to those relationships. METHODS: This qualitative study in Rwanda utilized convenience sampling to include eight focus group discussions with family planning providers, both family planning nurses and community health workers, as well as in-depth interviews with 32 experienced modern contraceptive users. Study participants were drawn from the two districts in Rwanda with the highest and lowest modern contraceptive rates, Musanze and Nyamasheke, respectively Data analysis was guided by the thematic content approach, Atlas.ti 8 was utilized for coding the transcripts and collating the coding results, and Microsoft Excel for analyzing the data within code. RESULTS: Data analysis revealed that, despite workplace related challenges – including inadequate staffing, training, and resources, relationships between providers and clients are strong. Family planning providers work hard to understand, learn from, and support clients in their initiation and sustained use of contraceptives. CONCLUSION: Given the existing context of purposeful efforts on the part of family planning providers to build relationships with their clients, if the current level of government support for family planning service provision is enhanced, Rwanda will likely sustain many current users of contraception and engage even more Rwandans in contraceptive services in the future. |
format | Online Article Text |
id | pubmed-8017655 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-80176552021-04-02 “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges Schwandt, Hilary M. Boulware, Angel Corey, Julia Herrera, Ana Hudler, Ethan Imbabazi, Claudette King, Ilia Linus, Jessica Manzi, Innocent Merritt, Madelyn Mezier, Lyn Miller, Abigail Morris, Haley Musemakweli, Dieudonne Musekura, Uwase Mutuyimana, Divine Ntakarutimana, Chimene Patel, Nirali Scanteianu, Adriana Shemeza, Biganette-Evidente Sterling-Donaldson, Giànna Umutoni, Chantal Uwera, Lyse Zeiler, Madeleine Feinberg, Seth BMC Health Serv Res Research Article BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study aims to understand the client-provider relationship in the Rwandan family planning program and to also examine barriers to those relationships. METHODS: This qualitative study in Rwanda utilized convenience sampling to include eight focus group discussions with family planning providers, both family planning nurses and community health workers, as well as in-depth interviews with 32 experienced modern contraceptive users. Study participants were drawn from the two districts in Rwanda with the highest and lowest modern contraceptive rates, Musanze and Nyamasheke, respectively Data analysis was guided by the thematic content approach, Atlas.ti 8 was utilized for coding the transcripts and collating the coding results, and Microsoft Excel for analyzing the data within code. RESULTS: Data analysis revealed that, despite workplace related challenges – including inadequate staffing, training, and resources, relationships between providers and clients are strong. Family planning providers work hard to understand, learn from, and support clients in their initiation and sustained use of contraceptives. CONCLUSION: Given the existing context of purposeful efforts on the part of family planning providers to build relationships with their clients, if the current level of government support for family planning service provision is enhanced, Rwanda will likely sustain many current users of contraception and engage even more Rwandans in contraceptive services in the future. BioMed Central 2021-04-01 /pmc/articles/PMC8017655/ /pubmed/33794871 http://dx.doi.org/10.1186/s12913-021-06282-x Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Schwandt, Hilary M. Boulware, Angel Corey, Julia Herrera, Ana Hudler, Ethan Imbabazi, Claudette King, Ilia Linus, Jessica Manzi, Innocent Merritt, Madelyn Mezier, Lyn Miller, Abigail Morris, Haley Musemakweli, Dieudonne Musekura, Uwase Mutuyimana, Divine Ntakarutimana, Chimene Patel, Nirali Scanteianu, Adriana Shemeza, Biganette-Evidente Sterling-Donaldson, Giànna Umutoni, Chantal Uwera, Lyse Zeiler, Madeleine Feinberg, Seth “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title_full | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title_fullStr | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title_full_unstemmed | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title_short | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges |
title_sort | “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in rwanda foster compassionate relationships with clients despite workplace challenges |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017655/ https://www.ncbi.nlm.nih.gov/pubmed/33794871 http://dx.doi.org/10.1186/s12913-021-06282-x |
work_keys_str_mv | AT schwandthilarym thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT boulwareangel thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT coreyjulia thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT herreraana thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT hudlerethan thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT imbabaziclaudette thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT kingilia thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT linusjessica thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT manziinnocent thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT merrittmadelyn thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT mezierlyn thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT millerabigail thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT morrishaley thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT musemakwelidieudonne thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT musekurauwase thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT mutuyimanadivine thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT ntakarutimanachimene thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT patelnirali thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT scanteianuadriana thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT shemezabiganetteevidente thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT sterlingdonaldsongianna thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT umutonichantal thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT uweralyse thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT zeilermadeleine thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges AT feinbergseth thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges |