Cargando…

“… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges

BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study ai...

Descripción completa

Detalles Bibliográficos
Autores principales: Schwandt, Hilary M., Boulware, Angel, Corey, Julia, Herrera, Ana, Hudler, Ethan, Imbabazi, Claudette, King, Ilia, Linus, Jessica, Manzi, Innocent, Merritt, Madelyn, Mezier, Lyn, Miller, Abigail, Morris, Haley, Musemakweli, Dieudonne, Musekura, Uwase, Mutuyimana, Divine, Ntakarutimana, Chimene, Patel, Nirali, Scanteianu, Adriana, Shemeza, Biganette-Evidente, Sterling-Donaldson, Giànna, Umutoni, Chantal, Uwera, Lyse, Zeiler, Madeleine, Feinberg, Seth
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017655/
https://www.ncbi.nlm.nih.gov/pubmed/33794871
http://dx.doi.org/10.1186/s12913-021-06282-x
_version_ 1783674092938854400
author Schwandt, Hilary M.
Boulware, Angel
Corey, Julia
Herrera, Ana
Hudler, Ethan
Imbabazi, Claudette
King, Ilia
Linus, Jessica
Manzi, Innocent
Merritt, Madelyn
Mezier, Lyn
Miller, Abigail
Morris, Haley
Musemakweli, Dieudonne
Musekura, Uwase
Mutuyimana, Divine
Ntakarutimana, Chimene
Patel, Nirali
Scanteianu, Adriana
Shemeza, Biganette-Evidente
Sterling-Donaldson, Giànna
Umutoni, Chantal
Uwera, Lyse
Zeiler, Madeleine
Feinberg, Seth
author_facet Schwandt, Hilary M.
Boulware, Angel
Corey, Julia
Herrera, Ana
Hudler, Ethan
Imbabazi, Claudette
King, Ilia
Linus, Jessica
Manzi, Innocent
Merritt, Madelyn
Mezier, Lyn
Miller, Abigail
Morris, Haley
Musemakweli, Dieudonne
Musekura, Uwase
Mutuyimana, Divine
Ntakarutimana, Chimene
Patel, Nirali
Scanteianu, Adriana
Shemeza, Biganette-Evidente
Sterling-Donaldson, Giànna
Umutoni, Chantal
Uwera, Lyse
Zeiler, Madeleine
Feinberg, Seth
author_sort Schwandt, Hilary M.
collection PubMed
description BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study aims to understand the client-provider relationship in the Rwandan family planning program and to also examine barriers to those relationships. METHODS: This qualitative study in Rwanda utilized convenience sampling to include eight focus group discussions with family planning providers, both family planning nurses and community health workers, as well as in-depth interviews with 32 experienced modern contraceptive users. Study participants were drawn from the two districts in Rwanda with the highest and lowest modern contraceptive rates, Musanze and Nyamasheke, respectively Data analysis was guided by the thematic content approach, Atlas.ti 8 was utilized for coding the transcripts and collating the coding results, and Microsoft Excel for analyzing the data within code. RESULTS: Data analysis revealed that, despite workplace related challenges – including inadequate staffing, training, and resources, relationships between providers and clients are strong. Family planning providers work hard to understand, learn from, and support clients in their initiation and sustained use of contraceptives. CONCLUSION: Given the existing context of purposeful efforts on the part of family planning providers to build relationships with their clients, if the current level of government support for family planning service provision is enhanced, Rwanda will likely sustain many current users of contraception and engage even more Rwandans in contraceptive services in the future.
format Online
Article
Text
id pubmed-8017655
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-80176552021-04-02 “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges Schwandt, Hilary M. Boulware, Angel Corey, Julia Herrera, Ana Hudler, Ethan Imbabazi, Claudette King, Ilia Linus, Jessica Manzi, Innocent Merritt, Madelyn Mezier, Lyn Miller, Abigail Morris, Haley Musemakweli, Dieudonne Musekura, Uwase Mutuyimana, Divine Ntakarutimana, Chimene Patel, Nirali Scanteianu, Adriana Shemeza, Biganette-Evidente Sterling-Donaldson, Giànna Umutoni, Chantal Uwera, Lyse Zeiler, Madeleine Feinberg, Seth BMC Health Serv Res Research Article BACKGROUND: Rwanda has markedly increased the nation’s contraceptive use in a short period of time, tripling contraceptive prevalence in just 5 years between 2005 and 2010. An integral aspect of family planning programs is the interactions between family planning providers and clients. This study aims to understand the client-provider relationship in the Rwandan family planning program and to also examine barriers to those relationships. METHODS: This qualitative study in Rwanda utilized convenience sampling to include eight focus group discussions with family planning providers, both family planning nurses and community health workers, as well as in-depth interviews with 32 experienced modern contraceptive users. Study participants were drawn from the two districts in Rwanda with the highest and lowest modern contraceptive rates, Musanze and Nyamasheke, respectively Data analysis was guided by the thematic content approach, Atlas.ti 8 was utilized for coding the transcripts and collating the coding results, and Microsoft Excel for analyzing the data within code. RESULTS: Data analysis revealed that, despite workplace related challenges – including inadequate staffing, training, and resources, relationships between providers and clients are strong. Family planning providers work hard to understand, learn from, and support clients in their initiation and sustained use of contraceptives. CONCLUSION: Given the existing context of purposeful efforts on the part of family planning providers to build relationships with their clients, if the current level of government support for family planning service provision is enhanced, Rwanda will likely sustain many current users of contraception and engage even more Rwandans in contraceptive services in the future. BioMed Central 2021-04-01 /pmc/articles/PMC8017655/ /pubmed/33794871 http://dx.doi.org/10.1186/s12913-021-06282-x Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Schwandt, Hilary M.
Boulware, Angel
Corey, Julia
Herrera, Ana
Hudler, Ethan
Imbabazi, Claudette
King, Ilia
Linus, Jessica
Manzi, Innocent
Merritt, Madelyn
Mezier, Lyn
Miller, Abigail
Morris, Haley
Musemakweli, Dieudonne
Musekura, Uwase
Mutuyimana, Divine
Ntakarutimana, Chimene
Patel, Nirali
Scanteianu, Adriana
Shemeza, Biganette-Evidente
Sterling-Donaldson, Giànna
Umutoni, Chantal
Uwera, Lyse
Zeiler, Madeleine
Feinberg, Seth
“… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title_full “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title_fullStr “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title_full_unstemmed “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title_short “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in Rwanda foster compassionate relationships with clients despite workplace challenges
title_sort “… the way we welcome them is how we will lead them to love family planning.”: family planning providers in rwanda foster compassionate relationships with clients despite workplace challenges
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8017655/
https://www.ncbi.nlm.nih.gov/pubmed/33794871
http://dx.doi.org/10.1186/s12913-021-06282-x
work_keys_str_mv AT schwandthilarym thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT boulwareangel thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT coreyjulia thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT herreraana thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT hudlerethan thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT imbabaziclaudette thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT kingilia thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT linusjessica thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT manziinnocent thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT merrittmadelyn thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT mezierlyn thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT millerabigail thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT morrishaley thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT musemakwelidieudonne thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT musekurauwase thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT mutuyimanadivine thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT ntakarutimanachimene thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT patelnirali thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT scanteianuadriana thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT shemezabiganetteevidente thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT sterlingdonaldsongianna thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT umutonichantal thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT uweralyse thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT zeilermadeleine thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges
AT feinbergseth thewaywewelcomethemishowwewillleadthemtolovefamilyplanningfamilyplanningprovidersinrwandafostercompassionaterelationshipswithclientsdespiteworkplacechallenges