Cargando…

Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate

INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to c...

Descripción completa

Detalles Bibliográficos
Autores principales: Venkatachalapathy, Vigneswara Srinivasan Sockkalingam, Rajeshkannan, Ramiah, Sarma, Manjit, Pooleri, Ginil Kumar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Wolters Kluwer - Medknow 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8033235/
https://www.ncbi.nlm.nih.gov/pubmed/33850359
http://dx.doi.org/10.4103/iju.IJU_238_20
_version_ 1783676372061782016
author Venkatachalapathy, Vigneswara Srinivasan Sockkalingam
Rajeshkannan, Ramiah
Sarma, Manjit
Pooleri, Ginil Kumar
author_facet Venkatachalapathy, Vigneswara Srinivasan Sockkalingam
Rajeshkannan, Ramiah
Sarma, Manjit
Pooleri, Ginil Kumar
author_sort Venkatachalapathy, Vigneswara Srinivasan Sockkalingam
collection PubMed
description INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to compare the diagnostic performance of WBBS with a single-photon emission computed tomography–computed tomography (SPECT-CT) correlation of the suspicious WBBS lesions to the axial skeleton (AS)-MRI in diagnosing bone metastasis in patients with carcinoma prostate. METHODS: WBBS and AS-MRI were both performed during the initial skeletal evaluation in 35 patients of carcinoma prostate with the prostate-specific antigen (PSA) in the range of 10–50 ng/ml. Suspicious lesions on the WBBS were correlated on SPECT CT. The presence or absence of metastasis was determined by best valuable comparator. The validity parameters of WBBS and AS-MRI were computed and compared. RESULTS: The sensitivity, specificity, positive predictive value, and negative predictive value of WBBS and AS-MRI for detecting patients with bone metastasis were 55.6%, 88.5%, 62.5%, 85.2% and 100.0%, 96.2%, 90.0%, 100%, respectively. The kappa value and the accuracy of WBBS were 0.457 and 80.0%, respectively. The kappa value and accuracy of AS-MRI were 0.928 and 97.1%, respectively. CONCLUSIONS: The diagnostic performance of AS-MRI in detecting patients with bone metastasis due to carcinoma prostate is superior to that of WBBS with SPECT-CT correlation of the suspicious lesions in the PSA range of 10–50 ng/ml.
format Online
Article
Text
id pubmed-8033235
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Wolters Kluwer - Medknow
record_format MEDLINE/PubMed
spelling pubmed-80332352021-04-12 Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate Venkatachalapathy, Vigneswara Srinivasan Sockkalingam Rajeshkannan, Ramiah Sarma, Manjit Pooleri, Ginil Kumar Indian J Urol Original Article INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to compare the diagnostic performance of WBBS with a single-photon emission computed tomography–computed tomography (SPECT-CT) correlation of the suspicious WBBS lesions to the axial skeleton (AS)-MRI in diagnosing bone metastasis in patients with carcinoma prostate. METHODS: WBBS and AS-MRI were both performed during the initial skeletal evaluation in 35 patients of carcinoma prostate with the prostate-specific antigen (PSA) in the range of 10–50 ng/ml. Suspicious lesions on the WBBS were correlated on SPECT CT. The presence or absence of metastasis was determined by best valuable comparator. The validity parameters of WBBS and AS-MRI were computed and compared. RESULTS: The sensitivity, specificity, positive predictive value, and negative predictive value of WBBS and AS-MRI for detecting patients with bone metastasis were 55.6%, 88.5%, 62.5%, 85.2% and 100.0%, 96.2%, 90.0%, 100%, respectively. The kappa value and the accuracy of WBBS were 0.457 and 80.0%, respectively. The kappa value and accuracy of AS-MRI were 0.928 and 97.1%, respectively. CONCLUSIONS: The diagnostic performance of AS-MRI in detecting patients with bone metastasis due to carcinoma prostate is superior to that of WBBS with SPECT-CT correlation of the suspicious lesions in the PSA range of 10–50 ng/ml. Wolters Kluwer - Medknow 2021 2021-01-01 /pmc/articles/PMC8033235/ /pubmed/33850359 http://dx.doi.org/10.4103/iju.IJU_238_20 Text en Copyright: © 2021 Indian Journal of Urology https://creativecommons.org/licenses/by-nc-sa/4.0/This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms.
spellingShingle Original Article
Venkatachalapathy, Vigneswara Srinivasan Sockkalingam
Rajeshkannan, Ramiah
Sarma, Manjit
Pooleri, Ginil Kumar
Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title_full Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title_fullStr Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title_full_unstemmed Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title_short Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
title_sort comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8033235/
https://www.ncbi.nlm.nih.gov/pubmed/33850359
http://dx.doi.org/10.4103/iju.IJU_238_20
work_keys_str_mv AT venkatachalapathyvigneswarasrinivasansockkalingam comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate
AT rajeshkannanramiah comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate
AT sarmamanjit comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate
AT pooleriginilkumar comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate