Cargando…
Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate
INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to c...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer - Medknow
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8033235/ https://www.ncbi.nlm.nih.gov/pubmed/33850359 http://dx.doi.org/10.4103/iju.IJU_238_20 |
_version_ | 1783676372061782016 |
---|---|
author | Venkatachalapathy, Vigneswara Srinivasan Sockkalingam Rajeshkannan, Ramiah Sarma, Manjit Pooleri, Ginil Kumar |
author_facet | Venkatachalapathy, Vigneswara Srinivasan Sockkalingam Rajeshkannan, Ramiah Sarma, Manjit Pooleri, Ginil Kumar |
author_sort | Venkatachalapathy, Vigneswara Srinivasan Sockkalingam |
collection | PubMed |
description | INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to compare the diagnostic performance of WBBS with a single-photon emission computed tomography–computed tomography (SPECT-CT) correlation of the suspicious WBBS lesions to the axial skeleton (AS)-MRI in diagnosing bone metastasis in patients with carcinoma prostate. METHODS: WBBS and AS-MRI were both performed during the initial skeletal evaluation in 35 patients of carcinoma prostate with the prostate-specific antigen (PSA) in the range of 10–50 ng/ml. Suspicious lesions on the WBBS were correlated on SPECT CT. The presence or absence of metastasis was determined by best valuable comparator. The validity parameters of WBBS and AS-MRI were computed and compared. RESULTS: The sensitivity, specificity, positive predictive value, and negative predictive value of WBBS and AS-MRI for detecting patients with bone metastasis were 55.6%, 88.5%, 62.5%, 85.2% and 100.0%, 96.2%, 90.0%, 100%, respectively. The kappa value and the accuracy of WBBS were 0.457 and 80.0%, respectively. The kappa value and accuracy of AS-MRI were 0.928 and 97.1%, respectively. CONCLUSIONS: The diagnostic performance of AS-MRI in detecting patients with bone metastasis due to carcinoma prostate is superior to that of WBBS with SPECT-CT correlation of the suspicious lesions in the PSA range of 10–50 ng/ml. |
format | Online Article Text |
id | pubmed-8033235 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Wolters Kluwer - Medknow |
record_format | MEDLINE/PubMed |
spelling | pubmed-80332352021-04-12 Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate Venkatachalapathy, Vigneswara Srinivasan Sockkalingam Rajeshkannan, Ramiah Sarma, Manjit Pooleri, Ginil Kumar Indian J Urol Original Article INTRODUCTION: Whole-body bone scintigraphy (WBBS) is considered to be the standard of care in the initial skeletal evaluation of patients with carcinoma prostate. Magnetic resonance imaging (MRI) is a potential alternative technique for detecting bone metastasis. The objective of this study was to compare the diagnostic performance of WBBS with a single-photon emission computed tomography–computed tomography (SPECT-CT) correlation of the suspicious WBBS lesions to the axial skeleton (AS)-MRI in diagnosing bone metastasis in patients with carcinoma prostate. METHODS: WBBS and AS-MRI were both performed during the initial skeletal evaluation in 35 patients of carcinoma prostate with the prostate-specific antigen (PSA) in the range of 10–50 ng/ml. Suspicious lesions on the WBBS were correlated on SPECT CT. The presence or absence of metastasis was determined by best valuable comparator. The validity parameters of WBBS and AS-MRI were computed and compared. RESULTS: The sensitivity, specificity, positive predictive value, and negative predictive value of WBBS and AS-MRI for detecting patients with bone metastasis were 55.6%, 88.5%, 62.5%, 85.2% and 100.0%, 96.2%, 90.0%, 100%, respectively. The kappa value and the accuracy of WBBS were 0.457 and 80.0%, respectively. The kappa value and accuracy of AS-MRI were 0.928 and 97.1%, respectively. CONCLUSIONS: The diagnostic performance of AS-MRI in detecting patients with bone metastasis due to carcinoma prostate is superior to that of WBBS with SPECT-CT correlation of the suspicious lesions in the PSA range of 10–50 ng/ml. Wolters Kluwer - Medknow 2021 2021-01-01 /pmc/articles/PMC8033235/ /pubmed/33850359 http://dx.doi.org/10.4103/iju.IJU_238_20 Text en Copyright: © 2021 Indian Journal of Urology https://creativecommons.org/licenses/by-nc-sa/4.0/This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms. |
spellingShingle | Original Article Venkatachalapathy, Vigneswara Srinivasan Sockkalingam Rajeshkannan, Ramiah Sarma, Manjit Pooleri, Ginil Kumar Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title | Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title_full | Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title_fullStr | Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title_full_unstemmed | Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title_short | Comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
title_sort | comparison of whole-body bone scintigraphy with axial skeleton magnetic resonance imaging in the skeletal evaluation of carcinoma prostate |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8033235/ https://www.ncbi.nlm.nih.gov/pubmed/33850359 http://dx.doi.org/10.4103/iju.IJU_238_20 |
work_keys_str_mv | AT venkatachalapathyvigneswarasrinivasansockkalingam comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate AT rajeshkannanramiah comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate AT sarmamanjit comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate AT pooleriginilkumar comparisonofwholebodybonescintigraphywithaxialskeletonmagneticresonanceimagingintheskeletalevaluationofcarcinomaprostate |