Cargando…

Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi

BACKGROUND: Provision of high-quality family planning (FP) services improves access to contraceptives. Negative experiences in maternal health have been documented worldwide and likely occur in other services including FP. This study aims to quantify disrespectful care for adult and adolescent women...

Descripción completa

Detalles Bibliográficos
Autores principales: Hazel, Elizabeth, Mohan, Diwakar, Chirwa, Ephraim, Phiri, Mary, Kachale, Fannie, Msukwa, Patrick, Katz, Joanne, Marx, Melissa A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8045277/
https://www.ncbi.nlm.nih.gov/pubmed/33853581
http://dx.doi.org/10.1186/s12913-021-06353-z
_version_ 1783678651311587328
author Hazel, Elizabeth
Mohan, Diwakar
Chirwa, Ephraim
Phiri, Mary
Kachale, Fannie
Msukwa, Patrick
Katz, Joanne
Marx, Melissa A.
author_facet Hazel, Elizabeth
Mohan, Diwakar
Chirwa, Ephraim
Phiri, Mary
Kachale, Fannie
Msukwa, Patrick
Katz, Joanne
Marx, Melissa A.
author_sort Hazel, Elizabeth
collection PubMed
description BACKGROUND: Provision of high-quality family planning (FP) services improves access to contraceptives. Negative experiences in maternal health have been documented worldwide and likely occur in other services including FP. This study aims to quantify disrespectful care for adult and adolescent women accessing FP in Malawi. METHODS: We used simulated clients (SCs) to measure disrespectful care in a census of public facilities in six districts of Malawi in 2018. SCs visited one provider in each of the 112 facilities: two SCs visits (one adult and one adolescent case scenario) or 224 SC visits total. We measured disrespectful care using a quantitative tool and field notes and report the prevalence and 95% confidence intervals for the indicators and by SC case scenarios contextualized with quotes from the field notes. RESULTS: Some SCs (12%) were refused care mostly because they did not agree to receive a HIV test or vaccination, or less commonly because the clinic was closed during operating hours. Over half (59%) of the visits did not have privacy. The SCs were not asked their contraceptive preference in 57% of the visits, 28% reported they were not greeted respectfully, and 20% reported interruptions. In 18% of the visits the SCs reported humiliation such as verbal abuse. Adults SCs received poorer counseling compared to the adolescent SCs with no other differences found. CONCLUSIONS: We documented instances of refusal of care, lack of privacy, poor client centered care and humiliating treatment by providers. We recommend continued effort to improve quality of care with an emphasis on client treatment, regular quality assessments that include measurement of disrespectful care, and more research on practices to reduce it. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06353-z.
format Online
Article
Text
id pubmed-8045277
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-80452772021-04-14 Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi Hazel, Elizabeth Mohan, Diwakar Chirwa, Ephraim Phiri, Mary Kachale, Fannie Msukwa, Patrick Katz, Joanne Marx, Melissa A. BMC Health Serv Res Research Article BACKGROUND: Provision of high-quality family planning (FP) services improves access to contraceptives. Negative experiences in maternal health have been documented worldwide and likely occur in other services including FP. This study aims to quantify disrespectful care for adult and adolescent women accessing FP in Malawi. METHODS: We used simulated clients (SCs) to measure disrespectful care in a census of public facilities in six districts of Malawi in 2018. SCs visited one provider in each of the 112 facilities: two SCs visits (one adult and one adolescent case scenario) or 224 SC visits total. We measured disrespectful care using a quantitative tool and field notes and report the prevalence and 95% confidence intervals for the indicators and by SC case scenarios contextualized with quotes from the field notes. RESULTS: Some SCs (12%) were refused care mostly because they did not agree to receive a HIV test or vaccination, or less commonly because the clinic was closed during operating hours. Over half (59%) of the visits did not have privacy. The SCs were not asked their contraceptive preference in 57% of the visits, 28% reported they were not greeted respectfully, and 20% reported interruptions. In 18% of the visits the SCs reported humiliation such as verbal abuse. Adults SCs received poorer counseling compared to the adolescent SCs with no other differences found. CONCLUSIONS: We documented instances of refusal of care, lack of privacy, poor client centered care and humiliating treatment by providers. We recommend continued effort to improve quality of care with an emphasis on client treatment, regular quality assessments that include measurement of disrespectful care, and more research on practices to reduce it. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06353-z. BioMed Central 2021-04-14 /pmc/articles/PMC8045277/ /pubmed/33853581 http://dx.doi.org/10.1186/s12913-021-06353-z Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Hazel, Elizabeth
Mohan, Diwakar
Chirwa, Ephraim
Phiri, Mary
Kachale, Fannie
Msukwa, Patrick
Katz, Joanne
Marx, Melissa A.
Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title_full Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title_fullStr Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title_full_unstemmed Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title_short Disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in Malawi
title_sort disrespectful care in family planning services among youth and adult simulated clients in public sector facilities in malawi
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8045277/
https://www.ncbi.nlm.nih.gov/pubmed/33853581
http://dx.doi.org/10.1186/s12913-021-06353-z
work_keys_str_mv AT hazelelizabeth disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT mohandiwakar disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT chirwaephraim disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT phirimary disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT kachalefannie disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT msukwapatrick disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT katzjoanne disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi
AT marxmelissaa disrespectfulcareinfamilyplanningservicesamongyouthandadultsimulatedclientsinpublicsectorfacilitiesinmalawi