Cargando…

The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway

Lung adenocarcinoma (LUAD) is the primary epithelial tumor of the lung. The lack of clinical symptoms and specific molecular diagnostic indicators during the early stages of LUAD mean that the disease may not be detected until late stages, and the 5‐year survival rate is only approximately 15%. Long...

Descripción completa

Detalles Bibliográficos
Autores principales: Luan, Tian, Zhang, Tian‐Ye, Lv, Zhong‐Hua, Guan, Bi‐Xi, Xu, Jian‐Yu, Li, Jian, Li, Ming‐Xu, Hu, Song‐Liu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8091588/
https://www.ncbi.nlm.nih.gov/pubmed/33683834
http://dx.doi.org/10.1002/2211-5463.13140
_version_ 1783687510273032192
author Luan, Tian
Zhang, Tian‐Ye
Lv, Zhong‐Hua
Guan, Bi‐Xi
Xu, Jian‐Yu
Li, Jian
Li, Ming‐Xu
Hu, Song‐Liu
author_facet Luan, Tian
Zhang, Tian‐Ye
Lv, Zhong‐Hua
Guan, Bi‐Xi
Xu, Jian‐Yu
Li, Jian
Li, Ming‐Xu
Hu, Song‐Liu
author_sort Luan, Tian
collection PubMed
description Lung adenocarcinoma (LUAD) is the primary epithelial tumor of the lung. The lack of clinical symptoms and specific molecular diagnostic indicators during the early stages of LUAD mean that the disease may not be detected until late stages, and the 5‐year survival rate is only approximately 15%. Long non‐coding RNA ALMS1 intronic script 1 (ALMS1‐IT1) was previously reported to be correlated with the poor prognosis of head and neck squamous cell carcinoma patients. Here, we investigated whether ALMS1‐IT1 has prognostic potential for LUAD. Bioinformatics analyses were performed to examine the expression and prognostic value of ALMS1 and AVL9 (for which gene expression is positively correlated with ALMS1‐IT1 expression in LUAD) in LUAD based on TCGA and Oncomine databases. We report that ALMS1‐IT1 and AVL9 were both highly expressed in LUAD and correlated with poor outcomes in LUAD patients. Of note, the prognosis of LUAD patients with low expression of both ALMS1‐IT1 and AVL9 was superior to that of other patients. Furthermore, the proliferation, migration and invasion of LUAD cells were decreased in cells lacking ALMS1‐IT1, and this decrease could be almost completely reversed through overexpression of AVL9. Gene set enrichment analysis revealed that expression of genes related to the cell cycle pathway is closely related to both the high expression of ALMS1‐IT1 and AVL9 in LUAD. Finally, up‐regulation of ALMS1‐IT1 can activate the cyclin‐dependent kinase pathway, whereas absence of AVL9 can reverse this activation, as shown by western blotting. In summary, ALMS1‐IT1/AVL9 may promote the malignant progression of LUAD, at least in part by regulating the cyclin‐dependent kinase pathway.
format Online
Article
Text
id pubmed-8091588
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-80915882021-05-10 The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway Luan, Tian Zhang, Tian‐Ye Lv, Zhong‐Hua Guan, Bi‐Xi Xu, Jian‐Yu Li, Jian Li, Ming‐Xu Hu, Song‐Liu FEBS Open Bio Research Articles Lung adenocarcinoma (LUAD) is the primary epithelial tumor of the lung. The lack of clinical symptoms and specific molecular diagnostic indicators during the early stages of LUAD mean that the disease may not be detected until late stages, and the 5‐year survival rate is only approximately 15%. Long non‐coding RNA ALMS1 intronic script 1 (ALMS1‐IT1) was previously reported to be correlated with the poor prognosis of head and neck squamous cell carcinoma patients. Here, we investigated whether ALMS1‐IT1 has prognostic potential for LUAD. Bioinformatics analyses were performed to examine the expression and prognostic value of ALMS1 and AVL9 (for which gene expression is positively correlated with ALMS1‐IT1 expression in LUAD) in LUAD based on TCGA and Oncomine databases. We report that ALMS1‐IT1 and AVL9 were both highly expressed in LUAD and correlated with poor outcomes in LUAD patients. Of note, the prognosis of LUAD patients with low expression of both ALMS1‐IT1 and AVL9 was superior to that of other patients. Furthermore, the proliferation, migration and invasion of LUAD cells were decreased in cells lacking ALMS1‐IT1, and this decrease could be almost completely reversed through overexpression of AVL9. Gene set enrichment analysis revealed that expression of genes related to the cell cycle pathway is closely related to both the high expression of ALMS1‐IT1 and AVL9 in LUAD. Finally, up‐regulation of ALMS1‐IT1 can activate the cyclin‐dependent kinase pathway, whereas absence of AVL9 can reverse this activation, as shown by western blotting. In summary, ALMS1‐IT1/AVL9 may promote the malignant progression of LUAD, at least in part by regulating the cyclin‐dependent kinase pathway. John Wiley and Sons Inc. 2021-04-03 /pmc/articles/PMC8091588/ /pubmed/33683834 http://dx.doi.org/10.1002/2211-5463.13140 Text en © 2021 The Authors. FEBS Open Bio published by John Wiley & Sons Ltd on behalf of Federation of European Biochemical Societies https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Articles
Luan, Tian
Zhang, Tian‐Ye
Lv, Zhong‐Hua
Guan, Bi‐Xi
Xu, Jian‐Yu
Li, Jian
Li, Ming‐Xu
Hu, Song‐Liu
The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title_full The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title_fullStr The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title_full_unstemmed The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title_short The lncRNA ALMS1‐IT1 may promote malignant progression of lung adenocarcinoma via AVL9‐mediated activation of the cyclin‐dependent kinase pathway
title_sort lncrna alms1‐it1 may promote malignant progression of lung adenocarcinoma via avl9‐mediated activation of the cyclin‐dependent kinase pathway
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8091588/
https://www.ncbi.nlm.nih.gov/pubmed/33683834
http://dx.doi.org/10.1002/2211-5463.13140
work_keys_str_mv AT luantian thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT zhangtianye thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT lvzhonghua thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT guanbixi thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT xujianyu thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT lijian thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT limingxu thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT husongliu thelncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT luantian lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT zhangtianye lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT lvzhonghua lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT guanbixi lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT xujianyu lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT lijian lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT limingxu lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway
AT husongliu lncrnaalms1it1maypromotemalignantprogressionoflungadenocarcinomaviaavl9mediatedactivationofthecyclindependentkinasepathway