Cargando…

Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats

Approximately 4.5 million women in the United States exhibit diabetes-associated ocular complications. The time course and magnitude of these complications, and their association with the dysregulation of the opioid growth factor (OGF)-OGF receptor (OGFr) signaling pathway are unknown. The present s...

Descripción completa

Detalles Bibliográficos
Autores principales: Purushothaman, Indira, Zagon, Ian S., Sassani, Joseph W., Mclaughlin, Patricia J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8112110/
https://www.ncbi.nlm.nih.gov/pubmed/33986852
http://dx.doi.org/10.3892/etm.2021.10119
_version_ 1783690626426994688
author Purushothaman, Indira
Zagon, Ian S.
Sassani, Joseph W.
Mclaughlin, Patricia J.
author_facet Purushothaman, Indira
Zagon, Ian S.
Sassani, Joseph W.
Mclaughlin, Patricia J.
author_sort Purushothaman, Indira
collection PubMed
description Approximately 4.5 million women in the United States exhibit diabetes-associated ocular complications. The time course and magnitude of these complications, and their association with the dysregulation of the opioid growth factor (OGF)-OGF receptor (OGFr) signaling pathway are unknown. The present study investigated the onset and magnitude of ocular surface complications and the association with a dysregulated OGF-OGFr signaling pathway in diabetic female rats. Adult female Sprague-Dawley rats were injected with streptozotocin in order to establish a model of type 1 diabetes (T1D), and a subset received insulin (T1D-INS). Blood glucose, body weight, tear production and corneal sensitivity, as well as serum and tissue expression levels of OGF and OGFr, were assessed. Corneal epithelial wound healing was also evaluated. In a second study, female T1D rats were treated with topical naltrexone (NTX) to determine whether blockade of the OGF-OGFr signaling pathway by NTX altered development of corneal surface complications. Female T1D rats had elevated glucose levels and reduced body weight compared with control and T1D-INS rats. In both diabetic groups, tear production was decreased within 2 weeks and corneal sensitivity was decreased 2.5-fold within 5 weeks, while corneal epithelial wound healing was delayed only in T1D rats. Serum and tissue levels of OGF and OGFr were elevated in diabetes. Twice daily NTX treatment reversed most ocular surface complications in the diabetic female rats. The present data demonstrated a seminal discovery in female T1D rats, in which the onset and magnitude of diabetes-associated ocular surface complications were associated with dysregulation of the OGF-OGFr regulatory pathway. Blockade of the OGF-OGFr pathway with the opioid receptor antagonist NTX prevented the onset and/or decreased the magnitude of these deficits. The current data support the need for translational research on this therapeutic approach for diabetic human subjects.
format Online
Article
Text
id pubmed-8112110
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-81121102021-05-12 Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats Purushothaman, Indira Zagon, Ian S. Sassani, Joseph W. Mclaughlin, Patricia J. Exp Ther Med Articles Approximately 4.5 million women in the United States exhibit diabetes-associated ocular complications. The time course and magnitude of these complications, and their association with the dysregulation of the opioid growth factor (OGF)-OGF receptor (OGFr) signaling pathway are unknown. The present study investigated the onset and magnitude of ocular surface complications and the association with a dysregulated OGF-OGFr signaling pathway in diabetic female rats. Adult female Sprague-Dawley rats were injected with streptozotocin in order to establish a model of type 1 diabetes (T1D), and a subset received insulin (T1D-INS). Blood glucose, body weight, tear production and corneal sensitivity, as well as serum and tissue expression levels of OGF and OGFr, were assessed. Corneal epithelial wound healing was also evaluated. In a second study, female T1D rats were treated with topical naltrexone (NTX) to determine whether blockade of the OGF-OGFr signaling pathway by NTX altered development of corneal surface complications. Female T1D rats had elevated glucose levels and reduced body weight compared with control and T1D-INS rats. In both diabetic groups, tear production was decreased within 2 weeks and corneal sensitivity was decreased 2.5-fold within 5 weeks, while corneal epithelial wound healing was delayed only in T1D rats. Serum and tissue levels of OGF and OGFr were elevated in diabetes. Twice daily NTX treatment reversed most ocular surface complications in the diabetic female rats. The present data demonstrated a seminal discovery in female T1D rats, in which the onset and magnitude of diabetes-associated ocular surface complications were associated with dysregulation of the OGF-OGFr regulatory pathway. Blockade of the OGF-OGFr pathway with the opioid receptor antagonist NTX prevented the onset and/or decreased the magnitude of these deficits. The current data support the need for translational research on this therapeutic approach for diabetic human subjects. D.A. Spandidos 2021-07 2021-04-28 /pmc/articles/PMC8112110/ /pubmed/33986852 http://dx.doi.org/10.3892/etm.2021.10119 Text en Copyright: © Purushothaman et al. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made.
spellingShingle Articles
Purushothaman, Indira
Zagon, Ian S.
Sassani, Joseph W.
Mclaughlin, Patricia J.
Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title_full Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title_fullStr Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title_full_unstemmed Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title_short Ocular surface complications result from dysregulation of the OGF-OGFr signaling pathway in female diabetic rats
title_sort ocular surface complications result from dysregulation of the ogf-ogfr signaling pathway in female diabetic rats
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8112110/
https://www.ncbi.nlm.nih.gov/pubmed/33986852
http://dx.doi.org/10.3892/etm.2021.10119
work_keys_str_mv AT purushothamanindira ocularsurfacecomplicationsresultfromdysregulationoftheogfogfrsignalingpathwayinfemalediabeticrats
AT zagonians ocularsurfacecomplicationsresultfromdysregulationoftheogfogfrsignalingpathwayinfemalediabeticrats
AT sassanijosephw ocularsurfacecomplicationsresultfromdysregulationoftheogfogfrsignalingpathwayinfemalediabeticrats
AT mclaughlinpatriciaj ocularsurfacecomplicationsresultfromdysregulationoftheogfogfrsignalingpathwayinfemalediabeticrats