Cargando…
“Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites
BACKGROUND: Community Health Workers (CHWs) have long been integrated in the delivery of HIV care in middle- and low-income countries. However, less is known about CHW integration into HIV care teams in the United States (US). To date, US-based CHW integration studies have studies explored integrati...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8120741/ https://www.ncbi.nlm.nih.gov/pubmed/33990190 http://dx.doi.org/10.1186/s12889-021-10943-1 |
_version_ | 1783692159694667776 |
---|---|
author | Sprague Martinez, Linda Davoust, Melissa Rajabiun, Serena Baughman, Allyson Bachman, Sara S. Bowers-Sword, Rachel Campos Rojo, Maria Sullivan, Marena Drainoni, Mari-Lynn |
author_facet | Sprague Martinez, Linda Davoust, Melissa Rajabiun, Serena Baughman, Allyson Bachman, Sara S. Bowers-Sword, Rachel Campos Rojo, Maria Sullivan, Marena Drainoni, Mari-Lynn |
author_sort | Sprague Martinez, Linda |
collection | PubMed |
description | BACKGROUND: Community Health Workers (CHWs) have long been integrated in the delivery of HIV care in middle- and low-income countries. However, less is known about CHW integration into HIV care teams in the United States (US). To date, US-based CHW integration studies have studies explored integration in the context of primary care and patient-centered medical homes. There is a need for research related to strategies that promote the successful integration of CHWs into HIV care delivery systems. In 2016, the Health Resources and Services Administration HIV/AIDS Bureau launched a three-year initiative to provide training, technical assistance and evaluation for Ryan White HIV/AIDS Program (RWHAP) recipient sites to integrate CHWs into their multidisciplinary care teams, and in turn strengthen their capacity to reach communities of color and reduce HIV inequities. METHODS: Ten RWHAP sites were selected from across eight states. The multi-site program evaluation included a process evaluation guided by RE-AIM to understand how the organizations integrated CHWs into their care teams. Site team members participated in group interviews to walk-the-process during early implementation and following the program period. Directed content analysis was employed to examine program implementation. Codes developed using implementation strategies outlined in the Expert Recommendations for Implementing Change project were applied to group interviews (n = 20). FINDINGS: Implementation strategies most frequently described by sites were associated with organizational-level adaptations in order to integrate the CHW into the HIV care team. These included revising, defining, and differentiating professional roles and changing organizational policies. Strategies used for implementation, such as network weaving, supervision, and promoting adaptability, were second most commonly cited strategies, followed by training and Technical Assistance strategies. CONCLUSIONS: Wrapped up in the implementation experience of the sites there were some underlying issues that pose challenges for healthcare organizations. Organizational policies and the ability to adapt proved significant in facilitating CHW program implementation. The integration of the CHWs in the delivery of HIV care requires clearly distinguishing their role from the roles of other members of the healthcare delivery team. |
format | Online Article Text |
id | pubmed-8120741 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-81207412021-05-17 “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites Sprague Martinez, Linda Davoust, Melissa Rajabiun, Serena Baughman, Allyson Bachman, Sara S. Bowers-Sword, Rachel Campos Rojo, Maria Sullivan, Marena Drainoni, Mari-Lynn BMC Public Health Research BACKGROUND: Community Health Workers (CHWs) have long been integrated in the delivery of HIV care in middle- and low-income countries. However, less is known about CHW integration into HIV care teams in the United States (US). To date, US-based CHW integration studies have studies explored integration in the context of primary care and patient-centered medical homes. There is a need for research related to strategies that promote the successful integration of CHWs into HIV care delivery systems. In 2016, the Health Resources and Services Administration HIV/AIDS Bureau launched a three-year initiative to provide training, technical assistance and evaluation for Ryan White HIV/AIDS Program (RWHAP) recipient sites to integrate CHWs into their multidisciplinary care teams, and in turn strengthen their capacity to reach communities of color and reduce HIV inequities. METHODS: Ten RWHAP sites were selected from across eight states. The multi-site program evaluation included a process evaluation guided by RE-AIM to understand how the organizations integrated CHWs into their care teams. Site team members participated in group interviews to walk-the-process during early implementation and following the program period. Directed content analysis was employed to examine program implementation. Codes developed using implementation strategies outlined in the Expert Recommendations for Implementing Change project were applied to group interviews (n = 20). FINDINGS: Implementation strategies most frequently described by sites were associated with organizational-level adaptations in order to integrate the CHW into the HIV care team. These included revising, defining, and differentiating professional roles and changing organizational policies. Strategies used for implementation, such as network weaving, supervision, and promoting adaptability, were second most commonly cited strategies, followed by training and Technical Assistance strategies. CONCLUSIONS: Wrapped up in the implementation experience of the sites there were some underlying issues that pose challenges for healthcare organizations. Organizational policies and the ability to adapt proved significant in facilitating CHW program implementation. The integration of the CHWs in the delivery of HIV care requires clearly distinguishing their role from the roles of other members of the healthcare delivery team. BioMed Central 2021-05-14 /pmc/articles/PMC8120741/ /pubmed/33990190 http://dx.doi.org/10.1186/s12889-021-10943-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Sprague Martinez, Linda Davoust, Melissa Rajabiun, Serena Baughman, Allyson Bachman, Sara S. Bowers-Sword, Rachel Campos Rojo, Maria Sullivan, Marena Drainoni, Mari-Lynn “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title | “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title_full | “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title_fullStr | “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title_full_unstemmed | “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title_short | “Part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten Ryan White HIV/AIDS program recipient sites |
title_sort | “part of getting to where we are is because we have been open to change” integrating community health workers on care teams at ten ryan white hiv/aids program recipient sites |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8120741/ https://www.ncbi.nlm.nih.gov/pubmed/33990190 http://dx.doi.org/10.1186/s12889-021-10943-1 |
work_keys_str_mv | AT spraguemartinezlinda partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT davoustmelissa partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT rajabiunserena partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT baughmanallyson partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT bachmansaras partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT bowersswordrachel partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT camposrojomaria partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT sullivanmarena partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites AT drainonimarilynn partofgettingtowhereweareisbecausewehavebeenopentochangeintegratingcommunityhealthworkersoncareteamsattenryanwhitehivaidsprogramrecipientsites |