Cargando…
Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.)
Unravelling the genetic architecture underlying yield components and agronomic traits is important for enhancing crop productivity. Here, a recombinant inbred line (RIL) population, developed from ICC 4958 and DCP 92–3 cross, was used for constructing linkage map and QTL mapping analysis. The RIL po...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8121343/ https://www.ncbi.nlm.nih.gov/pubmed/33989359 http://dx.doi.org/10.1371/journal.pone.0251669 |
_version_ | 1783692322679029760 |
---|---|
author | Barmukh, Rutwik Soren, Khela Ram Madugula, Praveen Gangwar, Priyanka Shanmugavadivel, P. S. Bharadwaj, Chellapilla Konda, Aravind K. Chaturvedi, Sushil K. Bhandari, Aditi Rajain, Kritika Singh, Narendra Pratap Roorkiwal, Manish Varshney, Rajeev K. |
author_facet | Barmukh, Rutwik Soren, Khela Ram Madugula, Praveen Gangwar, Priyanka Shanmugavadivel, P. S. Bharadwaj, Chellapilla Konda, Aravind K. Chaturvedi, Sushil K. Bhandari, Aditi Rajain, Kritika Singh, Narendra Pratap Roorkiwal, Manish Varshney, Rajeev K. |
author_sort | Barmukh, Rutwik |
collection | PubMed |
description | Unravelling the genetic architecture underlying yield components and agronomic traits is important for enhancing crop productivity. Here, a recombinant inbred line (RIL) population, developed from ICC 4958 and DCP 92–3 cross, was used for constructing linkage map and QTL mapping analysis. The RIL population was genotyped using a high-throughput Axiom(®)CicerSNP array, which enabled the development of a high-density genetic map consisting of 3,818 SNP markers and spanning a distance of 1064.14 cM. Analysis of phenotyping data for yield, yield components and agronomic traits measured across three years together with genetic mapping data led to the identification of 10 major-effect QTLs and six minor-effect QTLs explaining up to 59.70% phenotypic variance. The major-effect QTLs identified for 100-seed weight, and plant height possessed key genes, such as C3HC4 RING finger protein, pentatricopeptide repeat (PPR) protein, sugar transporter, leucine zipper protein and NADH dehydrogenase, amongst others. The gene ontology studies highlighted the role of these genes in regulating seed weight and plant height in crop plants. The identified genomic regions for yield, yield components, and agronomic traits, and the closely linked markers will help advance genetics research and breeding programs in chickpea. |
format | Online Article Text |
id | pubmed-8121343 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-81213432021-05-24 Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) Barmukh, Rutwik Soren, Khela Ram Madugula, Praveen Gangwar, Priyanka Shanmugavadivel, P. S. Bharadwaj, Chellapilla Konda, Aravind K. Chaturvedi, Sushil K. Bhandari, Aditi Rajain, Kritika Singh, Narendra Pratap Roorkiwal, Manish Varshney, Rajeev K. PLoS One Research Article Unravelling the genetic architecture underlying yield components and agronomic traits is important for enhancing crop productivity. Here, a recombinant inbred line (RIL) population, developed from ICC 4958 and DCP 92–3 cross, was used for constructing linkage map and QTL mapping analysis. The RIL population was genotyped using a high-throughput Axiom(®)CicerSNP array, which enabled the development of a high-density genetic map consisting of 3,818 SNP markers and spanning a distance of 1064.14 cM. Analysis of phenotyping data for yield, yield components and agronomic traits measured across three years together with genetic mapping data led to the identification of 10 major-effect QTLs and six minor-effect QTLs explaining up to 59.70% phenotypic variance. The major-effect QTLs identified for 100-seed weight, and plant height possessed key genes, such as C3HC4 RING finger protein, pentatricopeptide repeat (PPR) protein, sugar transporter, leucine zipper protein and NADH dehydrogenase, amongst others. The gene ontology studies highlighted the role of these genes in regulating seed weight and plant height in crop plants. The identified genomic regions for yield, yield components, and agronomic traits, and the closely linked markers will help advance genetics research and breeding programs in chickpea. Public Library of Science 2021-05-14 /pmc/articles/PMC8121343/ /pubmed/33989359 http://dx.doi.org/10.1371/journal.pone.0251669 Text en © 2021 Barmukh et al https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Barmukh, Rutwik Soren, Khela Ram Madugula, Praveen Gangwar, Priyanka Shanmugavadivel, P. S. Bharadwaj, Chellapilla Konda, Aravind K. Chaturvedi, Sushil K. Bhandari, Aditi Rajain, Kritika Singh, Narendra Pratap Roorkiwal, Manish Varshney, Rajeev K. Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title | Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title_full | Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title_fullStr | Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title_full_unstemmed | Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title_short | Construction of a high-density genetic map and QTL analysis for yield, yield components and agronomic traits in chickpea (Cicer arietinum L.) |
title_sort | construction of a high-density genetic map and qtl analysis for yield, yield components and agronomic traits in chickpea (cicer arietinum l.) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8121343/ https://www.ncbi.nlm.nih.gov/pubmed/33989359 http://dx.doi.org/10.1371/journal.pone.0251669 |
work_keys_str_mv | AT barmukhrutwik constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT sorenkhelaram constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT madugulapraveen constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT gangwarpriyanka constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT shanmugavadivelps constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT bharadwajchellapilla constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT kondaaravindk constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT chaturvedisushilk constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT bhandariaditi constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT rajainkritika constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT singhnarendrapratap constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT roorkiwalmanish constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml AT varshneyrajeevk constructionofahighdensitygeneticmapandqtlanalysisforyieldyieldcomponentsandagronomictraitsinchickpeacicerarietinuml |