Cargando…

Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)

Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5...

Descripción completa

Detalles Bibliográficos
Autores principales: Cai, Xingwei, Deng, Shuqing, Shen, Zhixin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8128221/
https://www.ncbi.nlm.nih.gov/pubmed/34027079
http://dx.doi.org/10.1080/23802359.2021.1927215
_version_ 1783694076470624256
author Cai, Xingwei
Deng, Shuqing
Shen, Zhixin
author_facet Cai, Xingwei
Deng, Shuqing
Shen, Zhixin
author_sort Cai, Xingwei
collection PubMed
description Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5% A, 25.4% T, 16.7% G, and 28.4% C. All genes were encoded on the H-strand except for ND6 and 8 tRNA genes, located on the l-strand. Phylogenetic analysis based on 13 protein-coding genes indicated that the genus Vanmanenia did not form monophyly and it had the closest relationship with Formosania. This study aimed at providing useful genetic information for future studies on taxonomy, phylogeny, and evolution of Vanmanenia species.
format Online
Article
Text
id pubmed-8128221
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-81282212021-05-21 Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) Cai, Xingwei Deng, Shuqing Shen, Zhixin Mitochondrial DNA B Resour Mitogenome Announcement Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5% A, 25.4% T, 16.7% G, and 28.4% C. All genes were encoded on the H-strand except for ND6 and 8 tRNA genes, located on the l-strand. Phylogenetic analysis based on 13 protein-coding genes indicated that the genus Vanmanenia did not form monophyly and it had the closest relationship with Formosania. This study aimed at providing useful genetic information for future studies on taxonomy, phylogeny, and evolution of Vanmanenia species. Taylor & Francis 2021-05-13 /pmc/articles/PMC8128221/ /pubmed/34027079 http://dx.doi.org/10.1080/23802359.2021.1927215 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Cai, Xingwei
Deng, Shuqing
Shen, Zhixin
Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title_full Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title_fullStr Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title_full_unstemmed Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title_short Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
title_sort complete mitochondrial genome of vanmanenia hainanensis (cypriniformes: gastromyzontidae)
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8128221/
https://www.ncbi.nlm.nih.gov/pubmed/34027079
http://dx.doi.org/10.1080/23802359.2021.1927215
work_keys_str_mv AT caixingwei completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae
AT dengshuqing completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae
AT shenzhixin completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae