Cargando…
Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae)
Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8128221/ https://www.ncbi.nlm.nih.gov/pubmed/34027079 http://dx.doi.org/10.1080/23802359.2021.1927215 |
_version_ | 1783694076470624256 |
---|---|
author | Cai, Xingwei Deng, Shuqing Shen, Zhixin |
author_facet | Cai, Xingwei Deng, Shuqing Shen, Zhixin |
author_sort | Cai, Xingwei |
collection | PubMed |
description | Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5% A, 25.4% T, 16.7% G, and 28.4% C. All genes were encoded on the H-strand except for ND6 and 8 tRNA genes, located on the l-strand. Phylogenetic analysis based on 13 protein-coding genes indicated that the genus Vanmanenia did not form monophyly and it had the closest relationship with Formosania. This study aimed at providing useful genetic information for future studies on taxonomy, phylogeny, and evolution of Vanmanenia species. |
format | Online Article Text |
id | pubmed-8128221 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-81282212021-05-21 Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) Cai, Xingwei Deng, Shuqing Shen, Zhixin Mitochondrial DNA B Resour Mitogenome Announcement Vanmanenia hainanensis Chen & Zheng 1980 is endemic to Hainan Island, China. The complete mitogenome of the species was sequenced in this study. It was 16,555 bp in length, containing 13 protein-coding genes (PCGs), 22 tRNA genes, 2 rRNA genes, and 1 control region. The base composition was 29.5% A, 25.4% T, 16.7% G, and 28.4% C. All genes were encoded on the H-strand except for ND6 and 8 tRNA genes, located on the l-strand. Phylogenetic analysis based on 13 protein-coding genes indicated that the genus Vanmanenia did not form monophyly and it had the closest relationship with Formosania. This study aimed at providing useful genetic information for future studies on taxonomy, phylogeny, and evolution of Vanmanenia species. Taylor & Francis 2021-05-13 /pmc/articles/PMC8128221/ /pubmed/34027079 http://dx.doi.org/10.1080/23802359.2021.1927215 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement Cai, Xingwei Deng, Shuqing Shen, Zhixin Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title | Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title_full | Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title_fullStr | Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title_full_unstemmed | Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title_short | Complete mitochondrial genome of Vanmanenia hainanensis (Cypriniformes: Gastromyzontidae) |
title_sort | complete mitochondrial genome of vanmanenia hainanensis (cypriniformes: gastromyzontidae) |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8128221/ https://www.ncbi.nlm.nih.gov/pubmed/34027079 http://dx.doi.org/10.1080/23802359.2021.1927215 |
work_keys_str_mv | AT caixingwei completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae AT dengshuqing completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae AT shenzhixin completemitochondrialgenomeofvanmaneniahainanensiscypriniformesgastromyzontidae |