Cargando…

Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats

Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been de...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhao, Mengli, Zhou, Huitong, Luo, Yuzhu, Wang, Jiqing, Hu, Jiang, Liu, Xiu, Li, Shaobin, Zhang, Kaiwen, Zhen, Huimin, Hickford, Jon G. H.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8143586/
https://www.ncbi.nlm.nih.gov/pubmed/33922107
http://dx.doi.org/10.3390/genes12050625
_version_ 1783696789191262208
author Zhao, Mengli
Zhou, Huitong
Luo, Yuzhu
Wang, Jiqing
Hu, Jiang
Liu, Xiu
Li, Shaobin
Zhang, Kaiwen
Zhen, Huimin
Hickford, Jon G. H.
author_facet Zhao, Mengli
Zhou, Huitong
Luo, Yuzhu
Wang, Jiqing
Hu, Jiang
Liu, Xiu
Li, Shaobin
Zhang, Kaiwen
Zhen, Huimin
Hickford, Jon G. H.
author_sort Zhao, Mengli
collection PubMed
description Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been described in goats and its effects on fiber traits are unknown. In this study, we identify the keratin-associated protein 1-2 gene (KRTAP1-2) in the goat genome and describe its effect on cashmere fiber traits in 359 Longdong cashmere goats. Six sequence variants (named CAPHI-KRTAP1-2*A to CAPHI-KRTAP1-2*F) were revealed using polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP) analysis. These sequences have the highest homology with ovine KRTAP1-2 sequences. There were a 60-bp deletion, a 15-bp insertion and five single nucleotide polymorphisms (SNPs) including two non-synonymous SNPs in the coding sequence. The caprine KRTAP1-2 gene was expressed in the skin tissue, but a signal was not observed for the kidneys, liver, lungs, spleen, heart and longissimus dorsi muscle. Variation in caprine KRTAP1-2 was found to be associated with raw cashmere fiber weight, but not with fiber diameter and length.
format Online
Article
Text
id pubmed-8143586
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-81435862021-05-25 Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats Zhao, Mengli Zhou, Huitong Luo, Yuzhu Wang, Jiqing Hu, Jiang Liu, Xiu Li, Shaobin Zhang, Kaiwen Zhen, Huimin Hickford, Jon G. H. Genes (Basel) Article Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been described in goats and its effects on fiber traits are unknown. In this study, we identify the keratin-associated protein 1-2 gene (KRTAP1-2) in the goat genome and describe its effect on cashmere fiber traits in 359 Longdong cashmere goats. Six sequence variants (named CAPHI-KRTAP1-2*A to CAPHI-KRTAP1-2*F) were revealed using polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP) analysis. These sequences have the highest homology with ovine KRTAP1-2 sequences. There were a 60-bp deletion, a 15-bp insertion and five single nucleotide polymorphisms (SNPs) including two non-synonymous SNPs in the coding sequence. The caprine KRTAP1-2 gene was expressed in the skin tissue, but a signal was not observed for the kidneys, liver, lungs, spleen, heart and longissimus dorsi muscle. Variation in caprine KRTAP1-2 was found to be associated with raw cashmere fiber weight, but not with fiber diameter and length. MDPI 2021-04-22 /pmc/articles/PMC8143586/ /pubmed/33922107 http://dx.doi.org/10.3390/genes12050625 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Zhao, Mengli
Zhou, Huitong
Luo, Yuzhu
Wang, Jiqing
Hu, Jiang
Liu, Xiu
Li, Shaobin
Zhang, Kaiwen
Zhen, Huimin
Hickford, Jon G. H.
Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title_full Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title_fullStr Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title_full_unstemmed Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title_short Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
title_sort variation in a newly identified caprine krtap gene is associated with raw cashmere fiber weight in longdong cashmere goats
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8143586/
https://www.ncbi.nlm.nih.gov/pubmed/33922107
http://dx.doi.org/10.3390/genes12050625
work_keys_str_mv AT zhaomengli variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT zhouhuitong variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT luoyuzhu variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT wangjiqing variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT hujiang variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT liuxiu variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT lishaobin variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT zhangkaiwen variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT zhenhuimin variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats
AT hickfordjongh variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats