Cargando…
Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats
Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been de...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8143586/ https://www.ncbi.nlm.nih.gov/pubmed/33922107 http://dx.doi.org/10.3390/genes12050625 |
_version_ | 1783696789191262208 |
---|---|
author | Zhao, Mengli Zhou, Huitong Luo, Yuzhu Wang, Jiqing Hu, Jiang Liu, Xiu Li, Shaobin Zhang, Kaiwen Zhen, Huimin Hickford, Jon G. H. |
author_facet | Zhao, Mengli Zhou, Huitong Luo, Yuzhu Wang, Jiqing Hu, Jiang Liu, Xiu Li, Shaobin Zhang, Kaiwen Zhen, Huimin Hickford, Jon G. H. |
author_sort | Zhao, Mengli |
collection | PubMed |
description | Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been described in goats and its effects on fiber traits are unknown. In this study, we identify the keratin-associated protein 1-2 gene (KRTAP1-2) in the goat genome and describe its effect on cashmere fiber traits in 359 Longdong cashmere goats. Six sequence variants (named CAPHI-KRTAP1-2*A to CAPHI-KRTAP1-2*F) were revealed using polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP) analysis. These sequences have the highest homology with ovine KRTAP1-2 sequences. There were a 60-bp deletion, a 15-bp insertion and five single nucleotide polymorphisms (SNPs) including two non-synonymous SNPs in the coding sequence. The caprine KRTAP1-2 gene was expressed in the skin tissue, but a signal was not observed for the kidneys, liver, lungs, spleen, heart and longissimus dorsi muscle. Variation in caprine KRTAP1-2 was found to be associated with raw cashmere fiber weight, but not with fiber diameter and length. |
format | Online Article Text |
id | pubmed-8143586 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-81435862021-05-25 Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats Zhao, Mengli Zhou, Huitong Luo, Yuzhu Wang, Jiqing Hu, Jiang Liu, Xiu Li, Shaobin Zhang, Kaiwen Zhen, Huimin Hickford, Jon G. H. Genes (Basel) Article Keratin-associated proteins (KAPs) and keratins determine the physical and chemical properties of cashmere fibers as they are the main components of the fibers. It has been reported that ovine KRTAP1-2 affects clean fleece weight, greasy fleece weight and yield in sheep, but the gene has not been described in goats and its effects on fiber traits are unknown. In this study, we identify the keratin-associated protein 1-2 gene (KRTAP1-2) in the goat genome and describe its effect on cashmere fiber traits in 359 Longdong cashmere goats. Six sequence variants (named CAPHI-KRTAP1-2*A to CAPHI-KRTAP1-2*F) were revealed using polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP) analysis. These sequences have the highest homology with ovine KRTAP1-2 sequences. There were a 60-bp deletion, a 15-bp insertion and five single nucleotide polymorphisms (SNPs) including two non-synonymous SNPs in the coding sequence. The caprine KRTAP1-2 gene was expressed in the skin tissue, but a signal was not observed for the kidneys, liver, lungs, spleen, heart and longissimus dorsi muscle. Variation in caprine KRTAP1-2 was found to be associated with raw cashmere fiber weight, but not with fiber diameter and length. MDPI 2021-04-22 /pmc/articles/PMC8143586/ /pubmed/33922107 http://dx.doi.org/10.3390/genes12050625 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Zhao, Mengli Zhou, Huitong Luo, Yuzhu Wang, Jiqing Hu, Jiang Liu, Xiu Li, Shaobin Zhang, Kaiwen Zhen, Huimin Hickford, Jon G. H. Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title | Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title_full | Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title_fullStr | Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title_full_unstemmed | Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title_short | Variation in a Newly Identified Caprine KRTAP Gene Is Associated with Raw Cashmere Fiber Weight in Longdong Cashmere Goats |
title_sort | variation in a newly identified caprine krtap gene is associated with raw cashmere fiber weight in longdong cashmere goats |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8143586/ https://www.ncbi.nlm.nih.gov/pubmed/33922107 http://dx.doi.org/10.3390/genes12050625 |
work_keys_str_mv | AT zhaomengli variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT zhouhuitong variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT luoyuzhu variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT wangjiqing variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT hujiang variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT liuxiu variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT lishaobin variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT zhangkaiwen variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT zhenhuimin variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats AT hickfordjongh variationinanewlyidentifiedcaprinekrtapgeneisassociatedwithrawcashmerefiberweightinlongdongcashmeregoats |