Cargando…

Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis

Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingl...

Descripción completa

Detalles Bibliográficos
Autores principales: Calimag, Katrina Paz D., Arbis, Czarina Catherine H., Collantes, Therese Marie A., Bariuan, Jussiaea V., Ang, Mary Jasmin C., Cervancia, Cleofas A., Desamero, Mark Joseph M., Estacio, Maria Amelita C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Japanese Association for Laboratory Animal Science 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8150248/
https://www.ncbi.nlm.nih.gov/pubmed/33239488
http://dx.doi.org/10.1538/expanim.20-0118
_version_ 1783698106472202240
author Calimag, Katrina Paz D.
Arbis, Czarina Catherine H.
Collantes, Therese Marie A.
Bariuan, Jussiaea V.
Ang, Mary Jasmin C.
Cervancia, Cleofas A.
Desamero, Mark Joseph M.
Estacio, Maria Amelita C.
author_facet Calimag, Katrina Paz D.
Arbis, Czarina Catherine H.
Collantes, Therese Marie A.
Bariuan, Jussiaea V.
Ang, Mary Jasmin C.
Cervancia, Cleofas A.
Desamero, Mark Joseph M.
Estacio, Maria Amelita C.
author_sort Calimag, Katrina Paz D.
collection PubMed
description Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingless bee propolis using the lambda (λ)-carrageenan-induced mice model of hind paw edema. Thirty (30), six-week-old, male ICR mice were randomly assigned into three treatment groups (n=10/group) as follows: distilled water group, diclofenac sodium group (10 mg/kg), and propolis group (100 mg/kg). All treatment were administered an hour prior to the injection of the phlogistic agent. As observed at 3 h post-injection, λ-carrageenan remarkably evoked the classical signs of hind paw edema exemplified grossly by swelling and hyperemia. The ameliorative effect of propolis became apparent at the onset of 6 h post-injection with a statistically significant finding evident at the 24-h period. This gross attenuation histologically correlated to a considerable and specific reduction of the dermal edema, which mirrored those of the diclofenac sodium group. Furthermore, both propolis and diclofenac sodium significantly attenuated the λ-carrageenan-induced increase in the protein expression levels of the pro-inflammatory cytokine tumor necrosis factor-α (TNF-α) depicting more than two-fold decrement relative to the distilled water group. Altogether, these suggest that Philippine stingless bee propolis also exhibited a promising in vivo anti-inflammatory property, which can be partly mediated through the inhibition of TNF-α.
format Online
Article
Text
id pubmed-8150248
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Japanese Association for Laboratory Animal Science
record_format MEDLINE/PubMed
spelling pubmed-81502482021-05-28 Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis Calimag, Katrina Paz D. Arbis, Czarina Catherine H. Collantes, Therese Marie A. Bariuan, Jussiaea V. Ang, Mary Jasmin C. Cervancia, Cleofas A. Desamero, Mark Joseph M. Estacio, Maria Amelita C. Exp Anim Original Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingless bee propolis using the lambda (λ)-carrageenan-induced mice model of hind paw edema. Thirty (30), six-week-old, male ICR mice were randomly assigned into three treatment groups (n=10/group) as follows: distilled water group, diclofenac sodium group (10 mg/kg), and propolis group (100 mg/kg). All treatment were administered an hour prior to the injection of the phlogistic agent. As observed at 3 h post-injection, λ-carrageenan remarkably evoked the classical signs of hind paw edema exemplified grossly by swelling and hyperemia. The ameliorative effect of propolis became apparent at the onset of 6 h post-injection with a statistically significant finding evident at the 24-h period. This gross attenuation histologically correlated to a considerable and specific reduction of the dermal edema, which mirrored those of the diclofenac sodium group. Furthermore, both propolis and diclofenac sodium significantly attenuated the λ-carrageenan-induced increase in the protein expression levels of the pro-inflammatory cytokine tumor necrosis factor-α (TNF-α) depicting more than two-fold decrement relative to the distilled water group. Altogether, these suggest that Philippine stingless bee propolis also exhibited a promising in vivo anti-inflammatory property, which can be partly mediated through the inhibition of TNF-α. Japanese Association for Laboratory Animal Science 2020-11-25 2021 /pmc/articles/PMC8150248/ /pubmed/33239488 http://dx.doi.org/10.1538/expanim.20-0118 Text en ©2021 Japanese Association for Laboratory Animal Science https://creativecommons.org/licenses/by-nc-nd/3.0/This is an open-access article distributed under the terms of the Creative Commons Attribution Non-Commercial No Derivatives (by-nc-nd) License.
spellingShingle Original
Calimag, Katrina Paz D.
Arbis, Czarina Catherine H.
Collantes, Therese Marie A.
Bariuan, Jussiaea V.
Ang, Mary Jasmin C.
Cervancia, Cleofas A.
Desamero, Mark Joseph M.
Estacio, Maria Amelita C.
Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title_full Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title_fullStr Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title_full_unstemmed Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title_short Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
title_sort attenuation of carrageenan-induced hind paw edema and plasma tnf-α level by philippine stingless bee (tetragonula biroi friese) propolis
topic Original
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8150248/
https://www.ncbi.nlm.nih.gov/pubmed/33239488
http://dx.doi.org/10.1538/expanim.20-0118
work_keys_str_mv AT calimagkatrinapazd attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT arbisczarinacatherineh attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT collantestheresemariea attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT bariuanjussiaeav attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT angmaryjasminc attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT cervanciacleofasa attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT desameromarkjosephm attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis
AT estaciomariaamelitac attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis