Cargando…
Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis
Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingl...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Japanese Association for Laboratory Animal Science
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8150248/ https://www.ncbi.nlm.nih.gov/pubmed/33239488 http://dx.doi.org/10.1538/expanim.20-0118 |
_version_ | 1783698106472202240 |
---|---|
author | Calimag, Katrina Paz D. Arbis, Czarina Catherine H. Collantes, Therese Marie A. Bariuan, Jussiaea V. Ang, Mary Jasmin C. Cervancia, Cleofas A. Desamero, Mark Joseph M. Estacio, Maria Amelita C. |
author_facet | Calimag, Katrina Paz D. Arbis, Czarina Catherine H. Collantes, Therese Marie A. Bariuan, Jussiaea V. Ang, Mary Jasmin C. Cervancia, Cleofas A. Desamero, Mark Joseph M. Estacio, Maria Amelita C. |
author_sort | Calimag, Katrina Paz D. |
collection | PubMed |
description | Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingless bee propolis using the lambda (λ)-carrageenan-induced mice model of hind paw edema. Thirty (30), six-week-old, male ICR mice were randomly assigned into three treatment groups (n=10/group) as follows: distilled water group, diclofenac sodium group (10 mg/kg), and propolis group (100 mg/kg). All treatment were administered an hour prior to the injection of the phlogistic agent. As observed at 3 h post-injection, λ-carrageenan remarkably evoked the classical signs of hind paw edema exemplified grossly by swelling and hyperemia. The ameliorative effect of propolis became apparent at the onset of 6 h post-injection with a statistically significant finding evident at the 24-h period. This gross attenuation histologically correlated to a considerable and specific reduction of the dermal edema, which mirrored those of the diclofenac sodium group. Furthermore, both propolis and diclofenac sodium significantly attenuated the λ-carrageenan-induced increase in the protein expression levels of the pro-inflammatory cytokine tumor necrosis factor-α (TNF-α) depicting more than two-fold decrement relative to the distilled water group. Altogether, these suggest that Philippine stingless bee propolis also exhibited a promising in vivo anti-inflammatory property, which can be partly mediated through the inhibition of TNF-α. |
format | Online Article Text |
id | pubmed-8150248 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Japanese Association for Laboratory Animal Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-81502482021-05-28 Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis Calimag, Katrina Paz D. Arbis, Czarina Catherine H. Collantes, Therese Marie A. Bariuan, Jussiaea V. Ang, Mary Jasmin C. Cervancia, Cleofas A. Desamero, Mark Joseph M. Estacio, Maria Amelita C. Exp Anim Original Despite decades-long existence of the Philippine stingless bee industry, the biological activity of propolis from this native bee species (Tetragonula biroi Friese) remains poorly understood and sparingly investigated. Herein, we examined the potential anti-inflammatory efficacy of Philippine stingless bee propolis using the lambda (λ)-carrageenan-induced mice model of hind paw edema. Thirty (30), six-week-old, male ICR mice were randomly assigned into three treatment groups (n=10/group) as follows: distilled water group, diclofenac sodium group (10 mg/kg), and propolis group (100 mg/kg). All treatment were administered an hour prior to the injection of the phlogistic agent. As observed at 3 h post-injection, λ-carrageenan remarkably evoked the classical signs of hind paw edema exemplified grossly by swelling and hyperemia. The ameliorative effect of propolis became apparent at the onset of 6 h post-injection with a statistically significant finding evident at the 24-h period. This gross attenuation histologically correlated to a considerable and specific reduction of the dermal edema, which mirrored those of the diclofenac sodium group. Furthermore, both propolis and diclofenac sodium significantly attenuated the λ-carrageenan-induced increase in the protein expression levels of the pro-inflammatory cytokine tumor necrosis factor-α (TNF-α) depicting more than two-fold decrement relative to the distilled water group. Altogether, these suggest that Philippine stingless bee propolis also exhibited a promising in vivo anti-inflammatory property, which can be partly mediated through the inhibition of TNF-α. Japanese Association for Laboratory Animal Science 2020-11-25 2021 /pmc/articles/PMC8150248/ /pubmed/33239488 http://dx.doi.org/10.1538/expanim.20-0118 Text en ©2021 Japanese Association for Laboratory Animal Science https://creativecommons.org/licenses/by-nc-nd/3.0/This is an open-access article distributed under the terms of the Creative Commons Attribution Non-Commercial No Derivatives (by-nc-nd) License. |
spellingShingle | Original Calimag, Katrina Paz D. Arbis, Czarina Catherine H. Collantes, Therese Marie A. Bariuan, Jussiaea V. Ang, Mary Jasmin C. Cervancia, Cleofas A. Desamero, Mark Joseph M. Estacio, Maria Amelita C. Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese) propolis |
title | Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese)
propolis |
title_full | Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese)
propolis |
title_fullStr | Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese)
propolis |
title_full_unstemmed | Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese)
propolis |
title_short | Attenuation of carrageenan-induced hind paw edema and plasma TNF-α level by Philippine stingless bee (Tetragonula biroi Friese)
propolis |
title_sort | attenuation of carrageenan-induced hind paw edema and plasma tnf-α level by philippine stingless bee (tetragonula biroi friese)
propolis |
topic | Original |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8150248/ https://www.ncbi.nlm.nih.gov/pubmed/33239488 http://dx.doi.org/10.1538/expanim.20-0118 |
work_keys_str_mv | AT calimagkatrinapazd attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT arbisczarinacatherineh attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT collantestheresemariea attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT bariuanjussiaeav attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT angmaryjasminc attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT cervanciacleofasa attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT desameromarkjosephm attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis AT estaciomariaamelitac attenuationofcarrageenaninducedhindpawedemaandplasmatnfalevelbyphilippinestinglessbeetetragonulabiroifriesepropolis |