Cargando…
Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review
The rice–wheat cropping system (RWCS) has substantially contributed in making India self-sufficient in food grain production; however, rice residue management is of great concern, threatening the sustainability of this system. Rice residue is invariably disposed of by farmers through open burning. I...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8151931/ https://www.ncbi.nlm.nih.gov/pubmed/34068758 http://dx.doi.org/10.3390/plants10050953 |
_version_ | 1783698500091904000 |
---|---|
author | Kaur, Ramanpreet Kaur, Simerjeet Deol, Jasdev Singh Sharma, Rajni Kaur, Tarundeep Brar, Ajmer Singh Choudhary, Om Parkash |
author_facet | Kaur, Ramanpreet Kaur, Simerjeet Deol, Jasdev Singh Sharma, Rajni Kaur, Tarundeep Brar, Ajmer Singh Choudhary, Om Parkash |
author_sort | Kaur, Ramanpreet |
collection | PubMed |
description | The rice–wheat cropping system (RWCS) has substantially contributed in making India self-sufficient in food grain production; however, rice residue management is of great concern, threatening the sustainability of this system. Rice residue is invariably disposed of by farmers through open burning. In addition to environmental pollution, residue burning of rice also leads to loss of soil nutrients. One of the alternatives to overcome these problems and sustain the RWCS is managing the rice residues in the field itself. Rice residue retention has variable effects on agricultural pests (namely, weeds, insect pests, diseases, and rodents) in the RWCS. High weed infestation in the RWCS results in high consumption of herbicides, which leads to several ecological problems and evolution of herbicide resistance. The shift from intensive tillage to conservation tillage causes major changes in weed dynamics and herbicide efficacy. Incorporation of rice residue reduces weed density and helps in improving soil physical, chemical, and biological properties. Rice residue retention on the surface or mulching reduces weed density and the biomass of both grass and broadleaf weeds in wheat crop as compared to its removal. Long-term field studies involving the use of rice residue as a component of integrated weed management strategies are needed to be done in the RWCS. |
format | Online Article Text |
id | pubmed-8151931 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-81519312021-05-27 Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review Kaur, Ramanpreet Kaur, Simerjeet Deol, Jasdev Singh Sharma, Rajni Kaur, Tarundeep Brar, Ajmer Singh Choudhary, Om Parkash Plants (Basel) Review The rice–wheat cropping system (RWCS) has substantially contributed in making India self-sufficient in food grain production; however, rice residue management is of great concern, threatening the sustainability of this system. Rice residue is invariably disposed of by farmers through open burning. In addition to environmental pollution, residue burning of rice also leads to loss of soil nutrients. One of the alternatives to overcome these problems and sustain the RWCS is managing the rice residues in the field itself. Rice residue retention has variable effects on agricultural pests (namely, weeds, insect pests, diseases, and rodents) in the RWCS. High weed infestation in the RWCS results in high consumption of herbicides, which leads to several ecological problems and evolution of herbicide resistance. The shift from intensive tillage to conservation tillage causes major changes in weed dynamics and herbicide efficacy. Incorporation of rice residue reduces weed density and helps in improving soil physical, chemical, and biological properties. Rice residue retention on the surface or mulching reduces weed density and the biomass of both grass and broadleaf weeds in wheat crop as compared to its removal. Long-term field studies involving the use of rice residue as a component of integrated weed management strategies are needed to be done in the RWCS. MDPI 2021-05-10 /pmc/articles/PMC8151931/ /pubmed/34068758 http://dx.doi.org/10.3390/plants10050953 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Kaur, Ramanpreet Kaur, Simerjeet Deol, Jasdev Singh Sharma, Rajni Kaur, Tarundeep Brar, Ajmer Singh Choudhary, Om Parkash Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title | Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title_full | Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title_fullStr | Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title_full_unstemmed | Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title_short | Soil Properties and Weed Dynamics in Wheat as Affected by Rice Residue Management in the Rice–Wheat Cropping System in South Asia: A Review |
title_sort | soil properties and weed dynamics in wheat as affected by rice residue management in the rice–wheat cropping system in south asia: a review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8151931/ https://www.ncbi.nlm.nih.gov/pubmed/34068758 http://dx.doi.org/10.3390/plants10050953 |
work_keys_str_mv | AT kaurramanpreet soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT kaursimerjeet soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT deoljasdevsingh soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT sharmarajni soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT kaurtarundeep soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT brarajmersingh soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview AT choudharyomparkash soilpropertiesandweeddynamicsinwheatasaffectedbyriceresiduemanagementinthericewheatcroppingsysteminsouthasiaareview |