Cargando…

Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions

pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifi...

Descripción completa

Detalles Bibliográficos
Autores principales: Xi, Yongkang, Liu, Bo, Jiang, Hang, Yin, Shouwei, Ngai, To, Yang, Xiaoquan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Royal Society of Chemistry 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8152521/
https://www.ncbi.nlm.nih.gov/pubmed/34122848
http://dx.doi.org/10.1039/c9sc05050g
_version_ 1783698624080773120
author Xi, Yongkang
Liu, Bo
Jiang, Hang
Yin, Shouwei
Ngai, To
Yang, Xiaoquan
author_facet Xi, Yongkang
Liu, Bo
Jiang, Hang
Yin, Shouwei
Ngai, To
Yang, Xiaoquan
author_sort Xi, Yongkang
collection PubMed
description pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifier. We demonstrate that the emulsification/demulsification of the obtained NaCas-stabilized emulsion can be triggered by simply changing the pH value over 100 cycles, which has never been observed in any protein-stabilized emulsion system. The NaCas-stabilized emulsion maintains its pH-responsive properties even in a saturated salt solution (NaCl ∼ 6.1 M) or seawater. We illustrate how NaCas functions in pH-responsive emulsions and show that when conventional nanoparticles such as zein protein or bare SiO(2) particles were coated with a layer of NaCas, the resulting formulated emulsions could be switched on and off over 10 cycles. The unique properties of NaCas thus enable the engineering of conventional Pickering emulsions to pH-responsive Pickering emulsions. Finally, we have integrated catalytically active gold (Au) nanoclusters (NCs) into the NaCas protein and then utilized them to produce emulsions. Remarkably, these NaCas–Au NCs assembled at the oil–water interface exhibited excellent catalytic activity and cyclability, not only in aqueous solution, but also in complicated seawater environments.
format Online
Article
Text
id pubmed-8152521
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher The Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-81525212021-06-11 Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions Xi, Yongkang Liu, Bo Jiang, Hang Yin, Shouwei Ngai, To Yang, Xiaoquan Chem Sci Chemistry pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifier. We demonstrate that the emulsification/demulsification of the obtained NaCas-stabilized emulsion can be triggered by simply changing the pH value over 100 cycles, which has never been observed in any protein-stabilized emulsion system. The NaCas-stabilized emulsion maintains its pH-responsive properties even in a saturated salt solution (NaCl ∼ 6.1 M) or seawater. We illustrate how NaCas functions in pH-responsive emulsions and show that when conventional nanoparticles such as zein protein or bare SiO(2) particles were coated with a layer of NaCas, the resulting formulated emulsions could be switched on and off over 10 cycles. The unique properties of NaCas thus enable the engineering of conventional Pickering emulsions to pH-responsive Pickering emulsions. Finally, we have integrated catalytically active gold (Au) nanoclusters (NCs) into the NaCas protein and then utilized them to produce emulsions. Remarkably, these NaCas–Au NCs assembled at the oil–water interface exhibited excellent catalytic activity and cyclability, not only in aqueous solution, but also in complicated seawater environments. The Royal Society of Chemistry 2020-03-16 /pmc/articles/PMC8152521/ /pubmed/34122848 http://dx.doi.org/10.1039/c9sc05050g Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by-nc/3.0/
spellingShingle Chemistry
Xi, Yongkang
Liu, Bo
Jiang, Hang
Yin, Shouwei
Ngai, To
Yang, Xiaoquan
Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title_full Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title_fullStr Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title_full_unstemmed Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title_short Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
title_sort sodium caseinate as a particulate emulsifier for making indefinitely recycled ph-responsive emulsions
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8152521/
https://www.ncbi.nlm.nih.gov/pubmed/34122848
http://dx.doi.org/10.1039/c9sc05050g
work_keys_str_mv AT xiyongkang sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions
AT liubo sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions
AT jianghang sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions
AT yinshouwei sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions
AT ngaito sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions
AT yangxiaoquan sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions