Cargando…
Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions
pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifi...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Royal Society of Chemistry
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8152521/ https://www.ncbi.nlm.nih.gov/pubmed/34122848 http://dx.doi.org/10.1039/c9sc05050g |
_version_ | 1783698624080773120 |
---|---|
author | Xi, Yongkang Liu, Bo Jiang, Hang Yin, Shouwei Ngai, To Yang, Xiaoquan |
author_facet | Xi, Yongkang Liu, Bo Jiang, Hang Yin, Shouwei Ngai, To Yang, Xiaoquan |
author_sort | Xi, Yongkang |
collection | PubMed |
description | pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifier. We demonstrate that the emulsification/demulsification of the obtained NaCas-stabilized emulsion can be triggered by simply changing the pH value over 100 cycles, which has never been observed in any protein-stabilized emulsion system. The NaCas-stabilized emulsion maintains its pH-responsive properties even in a saturated salt solution (NaCl ∼ 6.1 M) or seawater. We illustrate how NaCas functions in pH-responsive emulsions and show that when conventional nanoparticles such as zein protein or bare SiO(2) particles were coated with a layer of NaCas, the resulting formulated emulsions could be switched on and off over 10 cycles. The unique properties of NaCas thus enable the engineering of conventional Pickering emulsions to pH-responsive Pickering emulsions. Finally, we have integrated catalytically active gold (Au) nanoclusters (NCs) into the NaCas protein and then utilized them to produce emulsions. Remarkably, these NaCas–Au NCs assembled at the oil–water interface exhibited excellent catalytic activity and cyclability, not only in aqueous solution, but also in complicated seawater environments. |
format | Online Article Text |
id | pubmed-8152521 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | The Royal Society of Chemistry |
record_format | MEDLINE/PubMed |
spelling | pubmed-81525212021-06-11 Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions Xi, Yongkang Liu, Bo Jiang, Hang Yin, Shouwei Ngai, To Yang, Xiaoquan Chem Sci Chemistry pH-responsive emulsions are one of the simplest and most readily implementable stimuli-responsive systems. However, their practical uses have been greatly hindered by cyclability. Here, we report a robust pH-responsive emulsion prepared by utilizing pure sodium caseinate (NaCas) as the sole emulsifier. We demonstrate that the emulsification/demulsification of the obtained NaCas-stabilized emulsion can be triggered by simply changing the pH value over 100 cycles, which has never been observed in any protein-stabilized emulsion system. The NaCas-stabilized emulsion maintains its pH-responsive properties even in a saturated salt solution (NaCl ∼ 6.1 M) or seawater. We illustrate how NaCas functions in pH-responsive emulsions and show that when conventional nanoparticles such as zein protein or bare SiO(2) particles were coated with a layer of NaCas, the resulting formulated emulsions could be switched on and off over 10 cycles. The unique properties of NaCas thus enable the engineering of conventional Pickering emulsions to pH-responsive Pickering emulsions. Finally, we have integrated catalytically active gold (Au) nanoclusters (NCs) into the NaCas protein and then utilized them to produce emulsions. Remarkably, these NaCas–Au NCs assembled at the oil–water interface exhibited excellent catalytic activity and cyclability, not only in aqueous solution, but also in complicated seawater environments. The Royal Society of Chemistry 2020-03-16 /pmc/articles/PMC8152521/ /pubmed/34122848 http://dx.doi.org/10.1039/c9sc05050g Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by-nc/3.0/ |
spellingShingle | Chemistry Xi, Yongkang Liu, Bo Jiang, Hang Yin, Shouwei Ngai, To Yang, Xiaoquan Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title | Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title_full | Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title_fullStr | Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title_full_unstemmed | Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title_short | Sodium caseinate as a particulate emulsifier for making indefinitely recycled pH-responsive emulsions |
title_sort | sodium caseinate as a particulate emulsifier for making indefinitely recycled ph-responsive emulsions |
topic | Chemistry |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8152521/ https://www.ncbi.nlm.nih.gov/pubmed/34122848 http://dx.doi.org/10.1039/c9sc05050g |
work_keys_str_mv | AT xiyongkang sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions AT liubo sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions AT jianghang sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions AT yinshouwei sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions AT ngaito sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions AT yangxiaoquan sodiumcaseinateasaparticulateemulsifierformakingindefinitelyrecycledphresponsiveemulsions |