Cargando…

Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment

[Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study,...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Xingyue, Li, Qing, Xu, Xiaolin, Ding, Gang, Guo, Shunxing, Li, Biao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Chemical Society 2021
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8153664/
https://www.ncbi.nlm.nih.gov/pubmed/34056160
http://dx.doi.org/10.1021/acsomega.0c06325
_version_ 1783698850488254464
author Chen, Xingyue
Li, Qing
Xu, Xiaolin
Ding, Gang
Guo, Shunxing
Li, Biao
author_facet Chen, Xingyue
Li, Qing
Xu, Xiaolin
Ding, Gang
Guo, Shunxing
Li, Biao
author_sort Chen, Xingyue
collection PubMed
description [Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study, we verified the mechanism of symbiosis between MF23 and D. nobile on agar medium. The research carried out in this study on bark medium, similar to the natural environment, is of great importance because of its benefits for wide application. We found a significant effect, especially in the later period of cultivation, in which the highest dendrobine content in the experimental group was 0.147%, which is equivalent to 2.88 times that of the control group, and suggesting that MF23 promoted D. nobile in the natural environment, which verifies the application of the technique in field conditions. This result also implied that post-modification enzyme genes might play an important role in stimulating the biosynthesis of dendrobine.
format Online
Article
Text
id pubmed-8153664
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher American Chemical Society
record_format MEDLINE/PubMed
spelling pubmed-81536642021-05-27 Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment Chen, Xingyue Li, Qing Xu, Xiaolin Ding, Gang Guo, Shunxing Li, Biao ACS Omega [Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study, we verified the mechanism of symbiosis between MF23 and D. nobile on agar medium. The research carried out in this study on bark medium, similar to the natural environment, is of great importance because of its benefits for wide application. We found a significant effect, especially in the later period of cultivation, in which the highest dendrobine content in the experimental group was 0.147%, which is equivalent to 2.88 times that of the control group, and suggesting that MF23 promoted D. nobile in the natural environment, which verifies the application of the technique in field conditions. This result also implied that post-modification enzyme genes might play an important role in stimulating the biosynthesis of dendrobine. American Chemical Society 2021-04-07 /pmc/articles/PMC8153664/ /pubmed/34056160 http://dx.doi.org/10.1021/acsomega.0c06325 Text en © 2021 The Authors. Published by American Chemical Society Permits non-commercial access and re-use, provided that author attribution and integrity are maintained; but does not permit creation of adaptations or other derivative works (https://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Chen, Xingyue
Li, Qing
Xu, Xiaolin
Ding, Gang
Guo, Shunxing
Li, Biao
Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title_full Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title_fullStr Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title_full_unstemmed Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title_short Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
title_sort effects of the endophytic fungus mf23 on dendrobium nobile lindl. in an artificial primary environment
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8153664/
https://www.ncbi.nlm.nih.gov/pubmed/34056160
http://dx.doi.org/10.1021/acsomega.0c06325
work_keys_str_mv AT chenxingyue effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment
AT liqing effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment
AT xuxiaolin effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment
AT dinggang effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment
AT guoshunxing effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment
AT libiao effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment