Cargando…
Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment
[Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study,...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Chemical Society
2021
|
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8153664/ https://www.ncbi.nlm.nih.gov/pubmed/34056160 http://dx.doi.org/10.1021/acsomega.0c06325 |
_version_ | 1783698850488254464 |
---|---|
author | Chen, Xingyue Li, Qing Xu, Xiaolin Ding, Gang Guo, Shunxing Li, Biao |
author_facet | Chen, Xingyue Li, Qing Xu, Xiaolin Ding, Gang Guo, Shunxing Li, Biao |
author_sort | Chen, Xingyue |
collection | PubMed |
description | [Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study, we verified the mechanism of symbiosis between MF23 and D. nobile on agar medium. The research carried out in this study on bark medium, similar to the natural environment, is of great importance because of its benefits for wide application. We found a significant effect, especially in the later period of cultivation, in which the highest dendrobine content in the experimental group was 0.147%, which is equivalent to 2.88 times that of the control group, and suggesting that MF23 promoted D. nobile in the natural environment, which verifies the application of the technique in field conditions. This result also implied that post-modification enzyme genes might play an important role in stimulating the biosynthesis of dendrobine. |
format | Online Article Text |
id | pubmed-8153664 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | American Chemical Society |
record_format | MEDLINE/PubMed |
spelling | pubmed-81536642021-05-27 Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment Chen, Xingyue Li, Qing Xu, Xiaolin Ding, Gang Guo, Shunxing Li, Biao ACS Omega [Image: see text] The quality of Dendrobium nobile Lindl. is related to its endophytic fungi. It has been reported that the mycorrhizal fungus MF23 helps to increase the content of dendrobine in Dendrobium, but few studies have explained the mechanism underlying this phenomenon. In a previous study, we verified the mechanism of symbiosis between MF23 and D. nobile on agar medium. The research carried out in this study on bark medium, similar to the natural environment, is of great importance because of its benefits for wide application. We found a significant effect, especially in the later period of cultivation, in which the highest dendrobine content in the experimental group was 0.147%, which is equivalent to 2.88 times that of the control group, and suggesting that MF23 promoted D. nobile in the natural environment, which verifies the application of the technique in field conditions. This result also implied that post-modification enzyme genes might play an important role in stimulating the biosynthesis of dendrobine. American Chemical Society 2021-04-07 /pmc/articles/PMC8153664/ /pubmed/34056160 http://dx.doi.org/10.1021/acsomega.0c06325 Text en © 2021 The Authors. Published by American Chemical Society Permits non-commercial access and re-use, provided that author attribution and integrity are maintained; but does not permit creation of adaptations or other derivative works (https://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Chen, Xingyue Li, Qing Xu, Xiaolin Ding, Gang Guo, Shunxing Li, Biao Effects of the Endophytic Fungus MF23 on Dendrobium nobile Lindl. in an Artificial Primary Environment |
title | Effects of the Endophytic Fungus MF23 on Dendrobium
nobile Lindl. in an Artificial Primary
Environment |
title_full | Effects of the Endophytic Fungus MF23 on Dendrobium
nobile Lindl. in an Artificial Primary
Environment |
title_fullStr | Effects of the Endophytic Fungus MF23 on Dendrobium
nobile Lindl. in an Artificial Primary
Environment |
title_full_unstemmed | Effects of the Endophytic Fungus MF23 on Dendrobium
nobile Lindl. in an Artificial Primary
Environment |
title_short | Effects of the Endophytic Fungus MF23 on Dendrobium
nobile Lindl. in an Artificial Primary
Environment |
title_sort | effects of the endophytic fungus mf23 on dendrobium
nobile lindl. in an artificial primary
environment |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8153664/ https://www.ncbi.nlm.nih.gov/pubmed/34056160 http://dx.doi.org/10.1021/acsomega.0c06325 |
work_keys_str_mv | AT chenxingyue effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment AT liqing effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment AT xuxiaolin effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment AT dinggang effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment AT guoshunxing effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment AT libiao effectsoftheendophyticfungusmf23ondendrobiumnobilelindlinanartificialprimaryenvironment |