Cargando…

Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform

The use of biologics in positron emission tomography (PET) imaging is an important area of radiopharmaceutical development and new automated methods are required to facilitate their production. We report an automated radiosynthesis method to produce a radiolabelled biologic via facile inverse electr...

Descripción completa

Detalles Bibliográficos
Autores principales: Allott, Louis, Amgheib, Ala, Barnes, Chris, Braga, Marta, Brickute, Diana, Wang, Ning, Fu, Ruisi, Ghaem-Maghami, Sadaf, Aboagye, Eric O.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Royal Society of Chemistry 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8167423/
https://www.ncbi.nlm.nih.gov/pubmed/34123410
http://dx.doi.org/10.1039/d1re00117e
_version_ 1783701688483315712
author Allott, Louis
Amgheib, Ala
Barnes, Chris
Braga, Marta
Brickute, Diana
Wang, Ning
Fu, Ruisi
Ghaem-Maghami, Sadaf
Aboagye, Eric O.
author_facet Allott, Louis
Amgheib, Ala
Barnes, Chris
Braga, Marta
Brickute, Diana
Wang, Ning
Fu, Ruisi
Ghaem-Maghami, Sadaf
Aboagye, Eric O.
author_sort Allott, Louis
collection PubMed
description The use of biologics in positron emission tomography (PET) imaging is an important area of radiopharmaceutical development and new automated methods are required to facilitate their production. We report an automated radiosynthesis method to produce a radiolabelled biologic via facile inverse electron demand Diels–Alder (IEDDA) “click” chemistry on a single GE FASTLab™ cassette. We exemplified the method by producing a fluorine-18 radiolabelled interleukin-2 (IL2) radioconjugate from a trans-cyclooctene (TCO) modified IL2 precursor. The radioconjugate was produced using a fully automated radiosynthesis on a single FASTLab™ cassette in a decay-corrected radiochemical yield (RCY, d.c.) of 19.8 ± 2.6% in 110 min (from start of synthesis); the molar activity was 132.3 ± 14.6 GBq μmol(−1). The in vitro uptake of [(18)F]TTCO-IL2 correlated with the differential receptor expression (CD25, CD122, CD132) in PC3, NK-92 and activated human PBMCs. The automated method may be adapted for the radiosynthesis of any TCO-modified protein via IEDDA chemistry.
format Online
Article
Text
id pubmed-8167423
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher The Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-81674232021-06-11 Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform Allott, Louis Amgheib, Ala Barnes, Chris Braga, Marta Brickute, Diana Wang, Ning Fu, Ruisi Ghaem-Maghami, Sadaf Aboagye, Eric O. React Chem Eng Chemistry The use of biologics in positron emission tomography (PET) imaging is an important area of radiopharmaceutical development and new automated methods are required to facilitate their production. We report an automated radiosynthesis method to produce a radiolabelled biologic via facile inverse electron demand Diels–Alder (IEDDA) “click” chemistry on a single GE FASTLab™ cassette. We exemplified the method by producing a fluorine-18 radiolabelled interleukin-2 (IL2) radioconjugate from a trans-cyclooctene (TCO) modified IL2 precursor. The radioconjugate was produced using a fully automated radiosynthesis on a single FASTLab™ cassette in a decay-corrected radiochemical yield (RCY, d.c.) of 19.8 ± 2.6% in 110 min (from start of synthesis); the molar activity was 132.3 ± 14.6 GBq μmol(−1). The in vitro uptake of [(18)F]TTCO-IL2 correlated with the differential receptor expression (CD25, CD122, CD132) in PC3, NK-92 and activated human PBMCs. The automated method may be adapted for the radiosynthesis of any TCO-modified protein via IEDDA chemistry. The Royal Society of Chemistry 2021-04-15 /pmc/articles/PMC8167423/ /pubmed/34123410 http://dx.doi.org/10.1039/d1re00117e Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by/3.0/
spellingShingle Chemistry
Allott, Louis
Amgheib, Ala
Barnes, Chris
Braga, Marta
Brickute, Diana
Wang, Ning
Fu, Ruisi
Ghaem-Maghami, Sadaf
Aboagye, Eric O.
Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title_full Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title_fullStr Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title_full_unstemmed Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title_short Radiolabelling an (18)F biologic via facile IEDDA “click” chemistry on the GE FASTLab™ platform
title_sort radiolabelling an (18)f biologic via facile iedda “click” chemistry on the ge fastlab™ platform
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8167423/
https://www.ncbi.nlm.nih.gov/pubmed/34123410
http://dx.doi.org/10.1039/d1re00117e
work_keys_str_mv AT allottlouis radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT amgheibala radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT barneschris radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT bragamarta radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT brickutediana radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT wangning radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT furuisi radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT ghaemmaghamisadaf radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform
AT aboagyeerico radiolabellingan18fbiologicviafacileieddaclickchemistryonthegefastlabplatform